SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010364 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010364
Domain Number 1 Region: 568-829
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.51e-90
Family Eukaryotic proteases 0.0000000414
Further Details:      
 
Domain Number 2 Region: 314-421
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-30
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 3 Region: 189-307
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-20
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 4 Region: 61-142
Classification Level Classification E-value
Superfamily SEA domain 0.000000000000127
Family SEA domain 0.01
Further Details:      
 
Domain Number 5 Region: 463-500
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 498-536
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 428-463
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000126
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 8 Region: 538-579
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000421
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010364   Gene: ENSCPOG00000011522   Transcript: ENSCPOT00000011631
Sequence length 830
Comment pep:known_by_projection scaffold:cavPor3:scaffold_19:16118719:16131700:-1 gene:ENSCPOG00000011522 transcript:ENSCPOT00000011631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSMKGFEEGVEFLPVNSTKQVEKRGRRRWVLLAALLLGLLLLALVVGLLVWHFQRRDVQ
VQKIFNGYLRITNENFLDAYENSSSPEFLNLARKVTEALKLLYMEVPVLGPYYRKSAVTA
FSEGSVIAYYWSEFSIPQHLEEEAERAMAKKRVITLPPRGRALSNFMVTSVVAFPTDARA
LQRTQDNSCSFALHARGKEVTRFTTPGFPDSPYPARARCQWTLRGDAGSVLSLTFRSFDV
APCDGQNSDLVTVYNSLSPVEPHTVVRLCGAYPPSYNLTFLSSQNVLLVTLITSTERRHP
GFDASFFQLPKMSGCGGSLREAQGTFSTPYYPGRYPPNINCTWHIQVPNNQNVKLRFKYF
YLQEPNVVLGTCSKDYVEINGERYCGERPQFVVTSKSSKITVHFHSDHSYTDTGFLAEYL
SYDSKDPCPGMFTCGTGRCIRRELRCDGWADCTDHSDERNCSCNPSHQFTCKNQLCKPLF
WVCDGVNDCGDNSDELACKCPEGTFKCTSGKCLPEKQKCDGKDDCGDGSDEASCDTVSIV
TCTSHTFRCQNGLCVNKGNPECDGETDCSDGSDEKNCDCGLRSYSKRARVVGGTDSESGE
WPWQVSLHARGQGHVCGASLISPTWLVSAAHCFVDENSFKYSDPTKWTAFLGLLDQGQLT
ATGVQKHELKRIISHPSFNDFTFDYDIALLELKKPAEYSAVVQPICLPDAAHVFPPGKAI
WVTGWGHTEEGGTGALVLQKGEIRVINQTTCEALLPQQLTPRMMCVGFLSGGVDACQGDS
GGPLSSVEANGRIFQAGVVSWGEGCAQKNKPGVYTRLSMFRTWIKDQTGV
Download sequence
Identical sequences H0VJD4
ENSCPOP00000010364 ENSCPOP00000010364 10141.ENSCPOP00000010364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]