SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010392 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010392
Domain Number 1 Region: 43-274
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.81e-32
Family Hypothetical protein cg14615-pa 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010392   Gene: ENSCPOG00000011550   Transcript: ENSCPOT00000011661
Sequence length 292
Comment pep:known_by_projection scaffold:cavPor3:scaffold_44:8614307:8623736:-1 gene:ENSCPOG00000011550 transcript:ENSCPOT00000011661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVLNCSTKLLALEKILKSHFPESLKVYGAVMNINRGNPFQKEIVLDSWPDFKAVITRRQ
REAEADNLDHYTNAYAVFYKDIRAYHQLLEEPGVINWDQVFQIQGEQGHTNEKQFHDTIS
LTGFQIIKSNWYIKISQWTKPRIFNLETSSLQRTGGKLRTVSPPRLTHLSVNDADLLNRT
WSRGGNKQCLRYIAKLISCFPSVCVRDEKGNPVSWGITDQFATMCHGYTLPDHRRKGYSR
LVALTLARKLQSRGFPSQGNVRDDNEASINLLKSIHAEFLPCRFYRLILTPR
Download sequence
Identical sequences ENSCPOP00000010392 ENSCPOP00000010392 10141.ENSCPOP00000010392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]