SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010427 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010427
Domain Number 1 Region: 370-536,616-730
Classification Level Classification E-value
Superfamily L domain-like 1.68e-50
Family Ngr ectodomain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 136-349
Classification Level Classification E-value
Superfamily L domain-like 1.65e-40
Family Ngr ectodomain-like 0.0016
Further Details:      
 
Domain Number 3 Region: 1004-1194
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.49e-39
Family Laminin G-like module 0.0025
Further Details:      
 
Domain Number 4 Region: 1-109
Classification Level Classification E-value
Superfamily L domain-like 5.17e-26
Family Ngr ectodomain-like 0.0025
Further Details:      
 
Domain Number 5 Region: 818-862
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000011
Family EGF-type module 0.016
Further Details:      
 
Domain Number 6 Region: 859-902
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000226
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 774-816
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000042
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 8 Region: 897-935
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000773
Family EGF-type module 0.014
Further Details:      
 
Domain Number 9 Region: 933-973
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000001
Family EGF-type module 0.011
Further Details:      
 
Domain Number 10 Region: 1278-1307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000689
Family EGF-type module 0.015
Further Details:      
 
Domain Number 11 Region: 1231-1268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000010427
Domain Number - Region: 1197-1228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00171
Family EGF-type module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010427   Gene: ENSCPOG00000011591   Transcript: ENSCPOT00000011703
Sequence length 1385
Comment pep:known_by_projection scaffold:cavPor3:scaffold_17:14844788:15041827:-1 gene:ENSCPOG00000011591 transcript:ENSCPOT00000011703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLSENQIQGIPRKAFRGIADVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILV
TSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTIGQFTLCMAPVHLRGFNVADVQK
KEYVCPGPHSEAPSCNANSLSCPSSCTCSNNIVDCRGKGLTEIPANLPESIVEIRLEQNS
IKSIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNKITEIAKGLFDGL
VSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNP
FVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGTEDYRSRFSSE
CFMDLVCPEKCRCEGTIVDCSNQKLARIPSHLPEYVTDLRLNDNDISVLEATSIFKKLPN
LRKINLSNNKIKEVREGAFDGAAGVQELMLTGNQLETVHGRMFRGLSGLKTLMLRSNMIS
CVNNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWL
RKRRIVSGNPRCQRPFFLKEIPIQDVASQDFTCDGNDESSCQLSPRCPEQCTCVDTVVRC
SNKGLRALPKGMPKDVTELYLEGNHLTAVPRELSALRHLTLIDLSNNSIGMLTNYTFSNM
SHLSTLILSYNRLRCIPIHAFNGLQSLRVLTLHGNDISSVPEGSFNDLTSLSHLALGTNP
LHCDCNLRWLSEWVKAGYKEPGIARCSGPESMADRLLLTTPTHRFQCKGPVDINIVAKCN
ACLSGPCKNNGTCIPDPVEQYRCTCPYSYKGKDCTVPINTCIQNPCQHGGTCHLSESHKD
GFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCVCPPNYTGELCDEVIDHC
VPEMNLCQHEAKCVSLDKGFRCECVPGYSGKLCEINNDDCMAHKCRHGAQCVDAVNGYTC
ICPQGFSGVFCEHPPPMVLLQTSPCDQYECQNGAQCIIVQQEPTCRCPPGFAGPRCEKLI
TVNFVGKDSYVELASAKVRPQANISLQVATDKDNGILLYKGDNDPLALELYQGHVRLVYD
SLSSPPTTVYSVETVNDGQFHSVELVMLNQTLNLVVDKGAPKSLGKLQKQPAVGINSPLY
LGGIPTSTGLSALRQGADRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSPGCKSCTVC
KHGLCHSVEKDSVVCECHPGWTGPLCDQEARDPCLGHSCNHGRCVATGNSYVCKCAEGYG
GALCDRKNDSASVCSAFKCHHGQCQISDQGEPSCLCQPGFSGEHCEQENPCLGEVVREAI
HRQKGYTSCTTASKVPIMECRGGCGSQCCQPIRSKRRKYVFQCTDGSSFVEEVERHLECG
CSPCS
Download sequence
Identical sequences ENSCPOP00000010427 10141.ENSCPOP00000010427 ENSCPOP00000010427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]