SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010487 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010487
Domain Number 1 Region: 20-114
Classification Level Classification E-value
Superfamily Immunoglobulin 4.86e-20
Family V set domains (antibody variable domain-like) 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010487   Gene: ENSCPOG00000011661   Transcript: ENSCPOT00000011773
Sequence length 114
Comment pep:novel scaffold:cavPor3:scaffold_58:10167752:10168093:1 gene:ENSCPOG00000011661 transcript:ENSCPOT00000011773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRERLIMPPWSSGVLSDLTFQESGSNLLKLKETVPFTFTVGSGGSVTSNYFGSWICKQP
GRALPWMGYWTGSTNYNPALQSYISITANTANKKFSLQLNSVTSNDRVMYYCAR
Download sequence
Identical sequences ENSCPOP00000010487 ENSCPOP00000010487 10141.ENSCPOP00000010487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]