SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010518 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010518
Domain Number 1 Region: 308-576
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.11e-111
Family N-acetyl transferase, NAT 0.0000000000687
Further Details:      
 
Domain Number 2 Region: 52-123
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.86e-18
Family PHD domain 0.0056
Further Details:      
 
Domain Number 3 Region: 5-66
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000952
Family PHD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010518   Gene: ENSCPOG00000011695   Transcript: ENSCPOT00000011808
Sequence length 1672
Comment pep:known_by_projection scaffold:cavPor3:scaffold_80:1046945:1090453:1 gene:ENSCPOG00000011695 transcript:ENSCPOT00000011808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQC
IECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRPRKKGRKL
LQKKAAQIKRRYANPIGRPKNRLKKQNTVSKSPFSKVQTGPGRGRKRKITLSSQSASSSE
EGYLERIDGLDFCRDSSVPLKFNKKTKGLIDGLTKFFTPSPDGRKARGEVVDYSEQYRIR
KKGNRKSSTSDWPTDNQDGWDGKQESEERLFGSQEIMTEKDMELFRDIQEQALQKVGVTG
PPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKC
GWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQ
NDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPE
KPLSDLGRLSYMAYWKSVILECLHHQHDRQISIKRLSKLTGICPQDITSTLHHLRMLDFR
SDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVIVSNSVVSDDDEEADEEDNEE
PQCQEKDLETKISCGVYRSKRNNAFILMSSFDKHTTFDFLKSGGKLNKQVLPRDTLPANS
QPLRRGRWGRKNRKTQDQFGDKESTLLLEETSSAPQEQYGECEEKSEASQEQYAEREEQL
TASQEQPSQEGKPDIPKRRFSEGTELWQGQLKKSSEALKCRLPEGSQRLQRCYSDGDRAV
LRGFSESSEEEEEPESPRSNSPPVLTKPTLKRKKPILHRRRRVRKRKHHNSSVVTETISE
TTEVLDEPFEDSDSERPMPRLEPTFEIDEEEEEEDENELFHRGYFHRLSSQSVLRCRSSS
KRKSKEEEEDEESDDADDTPILNPVSLLRKCDMNSSSLEPDTSTPMKKKKGWPKGKSRKP
IHWKKRPGRKPGLKLNREIMAISPQECIIEPIPKPGRKTKTQENAETVELKEDMPFTTSS
EVRATSPVDSSNSPGVTIEANQNEDGHLESSKKKESEEQPVREEVKEEPGRQESFLDTNI
QNSRENIKDKDEIEPDSEEEQPSHEASVVSDHVPGSEDDHEEDSNAKEELIELKEEEEIP
HSELDLETVQAVQSLTQEERNEHEGAYQDCEETLAACQTLQSYTQADEDPQMSIVEDCHA
SEHNSPISSVQSHPSQSVRSVSSPNVPALESGYTQISPEQGSLSAPSMQNMETSPMMDVP
SVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDSTMGGSICGNNSSQSSCSFSGLSSSS
SLTQNSCVVTQQMANMGSSCSMMQQNTVQPASNCNIKSPQSCVVERPPTLSQCSMNNSFT
PAPMIMEIPESGSTGNISIYERIPGDFGASSYSQPSATFSLAKLQQLTNTIMDPHAMPYS
HSPAVTSYATSVSLSNTGLAQLAPSHPLAGTPQAQATMTPPPNLASTTMNLTSPLLQCNM
SATNIGIPHTQRLQGQMPVKGHISIRSKSAPLPSAAAHQQQLYGRSPPAVAMQAGPRALA
VQRGMNMGVNLMPTPAYNVNSMNMNTLNAMNSYRMTQPMMNSSYHSNPAYMNQTAQYPMQ
MQMGMMGSQAYTQQPMQPNPHGNMMYTGPSHHSYMNAAGVPKQSLNGPYSEK
Download sequence
Identical sequences ENSCPOP00000010518 10141.ENSCPOP00000010518 ENSCPOP00000010518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]