SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010522 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010522
Domain Number 1 Region: 4-102
Classification Level Classification E-value
Superfamily Lysozyme-like 3.49e-35
Family C-type lysozyme 0.0000817
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010522   Gene: ENSCPOG00000011699   Transcript: ENSCPOT00000011812
Sequence length 103
Comment pep:novel scaffold:cavPor3:scaffold_132:1580313:1582129:1 gene:ENSCPOG00000011699 transcript:ENSCPOT00000011812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASGLCMAHYESGFDTSFVDHNPDGSSEYGIFQLNSAWWCDNGITPTKNLCHMDCNDLLNR
HILDDIICVKQVVSSKNGMNAWDSWSRHCFDHDLSEWLKGCDM
Download sequence
Identical sequences ENSCPOP00000010522 ENSCPOP00000010522 10141.ENSCPOP00000010522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]