SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010587 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010587
Domain Number 1 Region: 81-261
Classification Level Classification E-value
Superfamily vWA-like 6.12e-39
Family Integrin A (or I) domain 0.0008
Further Details:      
 
Domain Number 2 Region: 1425-1624
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.81e-39
Family Pentraxin (pentaxin) 0.00042
Further Details:      
 
Domain Number 3 Region: 1961-2029
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-19
Family Complement control module/SCR domain 0.00095
Further Details:      
 
Domain Number 4 Region: 2144-2213
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.13e-18
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 5 Region: 2773-2842
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.67e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 6 Region: 2831-2900
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.78e-18
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 7 Region: 2379-2448
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.61e-18
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 8 Region: 1845-1914
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.17e-18
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 9 Region: 1787-1856
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.11e-17
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 10 Region: 3239-3308
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.78e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 11 Region: 2889-2958
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.7e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 12 Region: 2553-2620
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.08e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 13 Region: 2670-2726
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.47e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 14 Region: 1682-1745
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.75e-16
Family Complement control module/SCR domain 0.00068
Further Details:      
 
Domain Number 15 Region: 2263-2331
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.67e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 16 Region: 2437-2506
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000139
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 17 Region: 3298-3364
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000167
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 18 Region: 3416-3475
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000195
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 19 Region: 1903-1968
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000403
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 20 Region: 1220-1351
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000847
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 21 Region: 2202-2273
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000931
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 22 Region: 2495-2555
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000115
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 23 Region: 2715-2777
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000181
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 24 Region: 3063-3126
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000292
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 25 Region: 1630-1699
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000556
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 26 Region: 439-505
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000001
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 27 Region: 2948-3013
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000118
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 28 Region: 378-449
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000126
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 29 Region: 3007-3073
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000128
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 30 Region: 3121-3184
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000181
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 31 Region: 2018-2086
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000334
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 32 Region: 3357-3425
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000082
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 33 Region: 2322-2390
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000945
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 34 Region: 988-1132
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000353
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 35 Region: 1384-1424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000553
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 36 Region: 2083-2150
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000737
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 37 Region: 1346-1387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000209
Family EGF-type module 0.007
Further Details:      
 
Domain Number 38 Region: 3181-3244
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000334
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 39 Region: 1195-1232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000522
Family EGF-type module 0.011
Further Details:      
 
Domain Number 40 Region: 1741-1784
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000368
Family EGF-type module 0.032
Further Details:      
 
Domain Number 41 Region: 493-554
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000001
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Domain Number 42 Region: 279-435
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000179
Family Growth factor receptor domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000010587
Domain Number - Region: 3467-3503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000255
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 3506-3532
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000342
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 729-789
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00106
Family Complement control module/SCR domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010587   Gene: ENSCPOG00000011771   Transcript: ENSCPOT00000011886
Sequence length 3533
Comment pep:known_by_projection scaffold:cavPor3:scaffold_93:2628504:2796866:-1 gene:ENSCPOG00000011771 transcript:ENSCPOT00000011886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPRLAFCCWGLALVSGWTTFQQTSPSRNFSFRLFPEAAPGAPGRLSSVPPAPGEEEPAE
SKVERLGRAFRRRVRRLRELSERLELVFLVDESSSVGHANFRSELKFVRKLLSDFPVVST
ATRVAIVTFASKSNVVPRVDYISSRRAHQHKCALLSREIPAITYRGGGTYTKGAFQQAAQ
ILRHARENSTKVIFLITDGYSNGGDPRPVAASLRDLGVEIFTFGIWQGNIRELNDMASSP
KEEHCYLLHSFEEFEALARRALHEDLPSGSFIQEDMSHCSYLCEAGKDCCDRMASCKCGT
HTGQFECICEKGYYGKGLQYECTACPSGTYKPEGSPGGISTCIPCPDENHTSPPGSTSPE
DCVCKEGYRASGQMCEVVHCPALKPPENGYFIQNTCNNHFNAACGVRCHPGFDLVGSSIL
LCLPNGLWSSSESSCRVRTCPHLRQPKHGRISCSTRDMSYRTTCLVTCDEGYRLEGSAKL
TCQGNSHWDGGEPRCVERHCAVFQKPKGVIVSPPTCGKQPATPGMLCQLSCRPGFILSGA
REVRCTTSGKWSARVQTAVCKADMEPPQINCPKDIEAQTQKQQDSANITWQIPTAKDNSG
EKVSLHVHPAFTPPYLFPIGDVAITYTATDSSSNQATCTFHIKVIDVEPPVIDRCRSPPP
VQVSEKEYPASWDEPQFSDNSGAVLVITRSHTPGDLFPQGETIVKYTATDPSGNNRTCNI
HIIIKGSPCEVPFTPTNGNFMCTQDSIGVNCTLSCLEGYDFTEGSMEKYYCAYEDGIWKP
PYSTEWPDCAIKRFANHGFKSFEMLYKATRCNDMDLLKKFSEAFETTLGKMVPTFCSDDD
DIDCKLEDLTKKYCLEYNYDYENGFAIGPGGWGAANRLDYSYDDFLDAVQETPTGVSKAR
SSRIKKSVPLSDHKIKLIFNITASVPLPDERNDTLELENQQRLIRTLETITNRLKRTLHT
EPMYSFQLASEMLVADTNSLETEKAFLFCRPGSVLRGRMCVNCPLGTYYSLEHSACESCR
LGSYQDEEGQLECKLCPAGTYTEYLHSRSISECKAQCKQGTYSSNGLETCESCPLGTYQP
EFGSRSCLLCPEPTSTVKRGAVDISACGVPCPIGEFSRTGLMPCYPCPQDYYQPDPGKSF
CLSCPFYGTTTITGARSITDCSSFSSTFSAAEESIVPLASAGHIQTKYEVSSQVFHECFL
NPCHNNGTCQQIGRGYVCLCPPGYTGLKCETDIDECSSLPCLNNGICKDQVGGFICECVL
GYTGQLCEKNTDECSSGPCLNKGTCVDGVAGYRCTCVKGYIGLHCETEVDECQSSPCFNN
AACEDQVGGFLCKCPPGYLGTRCEINIDECLSQPCQNGATCKDGANSFRCHCAAGFTGSH
CESNINECQSNPCRNQATCVDETNSYSCKCRPGFSGSRCETEQSTGFNLDFEVSGIYGYV
MLDSVLPSLHAVTCAFWMNSSDTFNYGTPISYALDDSDNTFLLTDYNGWVLYVNGKERIT
NCPSVNDGSWHHIAITWTSAGGVWKVYIDGKLSDSGSGLSVGTAIPGGGSLVLGQEQDKK
GEGFSPAESFVGSISQLNLWDYVLSPQQVKSLATSCPEELSKGNVLAWPDFLSGVVGKVK
VDSKSIFCSECPPLDGSVPHLRTASADLKPGSKVTLFCDPGFQMVGNPVQHCLNQGQWTQ
PLPRCERISCGVPPPLENGFYSAEDVHAGSTVTYQCNNGYYLLGDSRMFCTDNGNWNGIS
PSCLDVDECAVGSDCSEHASCLNTNGSYVCSCIPPYTGDGKKCAEPIKCKIPENPENGYS
SGEIYTVGAEVTFSCEEGYQLMGVTKITCLMSGEWSHLRPHCEAVSCGAPAIPENGGIDG
SAFTYGSKVTYRCNKGYTLAGDKETSCLASGSWSHSSPVCELVKCSSPESINNGNYVLSG
LTFLSTALYSCESGYSLQGPSFIECTASGSWDRAPPTCHLVSCGEPPTIKDAVITGSNFT
FGSTVTYTCKEGYTLAGPDTIECLANGQWSGSSQQCLAVSCDEPPNVDHASPETAHRLFG
DIAFYYCSDGYSLADNSQLLCNAQGKWVPPEGQTMPRCIAHFCEKPPSVSYGILESVSKA
KFAAGSVVSFKCMEGFVLNTSAKIECVRGGQWTPSPLSIQCIPVRCGEPPSILNGYASGS
NYSFGAMVAYSCHKGFFIKGEKKTTCEATGRWSSPIPTCHPVSCSEPPKIENGFLEHTTG
RTFESEVRYQCNPGYKPVGSPVFVCQANRHWHSESPLSCIPLNCGKPPPIQNGFTRGETF
EVGSKVQFFCDEGYELIGDNFWTCQKSGKWNKKLTPKCVLAKCPDPPLLENQLILKELTS
EVGVVTLSCREGHILQGPSVLKCLPSQQWNDSFPVCKMVLCLPPPLIPFGAPASSTLYFG
STVTYSCVEGFFLRGNPATVCQADGTWSSPLPECVPVECPQPEDILNGMVDVQGLAYLST
ALYTCKPGFELVGNTTTLCGEDGHWLGGKPTCKPIECPKPKEILNGKFSYTNLHFGKTVT
YSCDRGFSLEGPSALTCLETGDWDVDAPSCNAIHCNPPQPIENGFVEGADYSYGAVIIYS
CFPGFQVTGHAMQTCEETGWSSSIPTCVPIDCGLPPHIDFGDCTKVKDGQEYFDQEVDMM
EVPYLTSHPPRHLEVVTKTLENTKESSPAMHSSNFLYGTIVLYTCNPGYELLGNPMLICQ
EDGTWNGSAPSCISVECDLPIAPENGFLHFAETTLGSAAQYSCKPGHILVGPDIRLCLQN
RKWSGASPRCEAILCTKPNPVMNGYVKGNSYTYLSVVHYECDPGYVLNGTKNRTCQENKN
WDGHEPSCIPVDCGSPPVPANGQVEGDKYTFQKEIEYTCTEGFLLEGARSRVCLVNGSWS
GDNPICIPIKCANPLQIENGIMDGSDYGFKKEVVFHCNEGYVLHGAPKLTCQSDGNWDEE
VPLCKPASCVPPEDLAHGFPNGFSFYHGRDIQYQCFPGYKLHGSSLRKCLSNGSWSGSPP
SCLSCRCSTPEIPYGTINGTDFDCGKTVKIQCFKGFHLLGLSEITCEANGQWSSGFPHCE
HTLCGSLPAIPNAVTRESEPLQENVITYSCRSGYVMQGSSDLICTEKGTWSQPYPVCEPL
SCGPPPFVANAVVTGEEHTYESKVKLRCLEGYVMDTDTDTFTCQKDGHWFPEMISCSSKN
CSLPLNLTNVLVHGDDFSVNKQVSLSCAEGYTYNGVNISTCQLDGTWEPAFSDESCSPVS
CGKPESPEHGFVIGSSYRFKSIIIYQCEPGYELEGNRECICQEDGRWSGEVATCTKTRCR
APSEFLNGDVNMENTTEGLSITYSCHRGYSLEGPPRAQCTENGTWSHPAPLCKPNPCPVP
FVIPENALLSEKEFYVDQNVSIRCREGFLLMGQGVITCNPDETWTQTSAKCEKISCGPPT
HVENAIARGIHYQYGDMITYSCYSGYMLEGSLRSVCLENGTWTSPPICRAVCRFPCQNGG
VCQRPNACSCPDGWMGRLCEEPICILPCLNGGRCVAPYQCDCPPGWTGARCHT
Download sequence
Identical sequences 10141.ENSCPOP00000010587 ENSCPOP00000010587 ENSCPOP00000010587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]