SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010626 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010626
Domain Number 1 Region: 36-151
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.59e-34
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 2 Region: 165-289
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-18
Family Spermadhesin, CUB domain 0.0038
Further Details:      
 
Domain Number 3 Region: 288-324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000012
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010626   Gene: ENSCPOG00000011813   Transcript: ENSCPOT00000011928
Sequence length 517
Comment pep:known_by_projection scaffold:cavPor3:scaffold_33:6539440:6564921:1 gene:ENSCPOG00000011813 transcript:ENSCPOT00000011928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFLVLLITVLVVEGIAVAQKTQDGQNIGIKHIPATQCGIWVRTSNGGHFASPNYPDSYPP
NKECIYILEAAPRQRIELTFDEHYYIEPSFECRFDHLEVRDGPFGFSPLIDRYCGMKSPP
LIRSTGRFMWIKFSSDEELEGLGFRAKYSFIPDPDFTYLGGILNPIPDCQFELSGADGIV
RSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQMEHSNECKRNFVAVYDGSSAI
ENLKAKFCSTVANDVMLKTGVGVIRMWADEGSRLSRFRMLFTSFVEPPCTGSTFFCHSNM
CINNSLVCNGVQNCAYPWDENHCKEKKKAGLFEQITKTHGTIIGVTSGIVLVLLIISILV
QVKQPRKKVMACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELDNYQKMRRS
SAASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFKQA
HECPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF
Download sequence
Identical sequences ENSCPOP00000010626 10141.ENSCPOP00000010626 ENSCPOP00000010626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]