SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010643 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010643
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Kringle-like 4.35e-26
Family Kringle modules 0.00084
Further Details:      
 
Domain Number 2 Region: 184-291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-25
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010643   Gene: ENSCPOG00000011832   Transcript: ENSCPOT00000011947
Sequence length 443
Comment pep:known_by_projection scaffold:cavPor3:scaffold_4:14041410:14090421:-1 gene:ENSCPOG00000011832 transcript:ENSCPOT00000011947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNTLKYPNGEGGLGEHNYCRNPDGD
VSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCISF
CRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFDTL
VGACGGNYSAMTSVVYSPDFPDTYATGRVCYWTIRVPGASHIHFNFTLFDIRDSADMVEL
LDGYTHRVLVRFNGRNRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAIKEELLQERP
TVNQTLAEVITEQANLSVSAAHSSKVLYVITTSPSHPSQTVPGSSSWAPAVGAGSHRVEG
WTVYGLATLLILTVTAIVAKILLHVTLKSHRVPASGDLRDCRQPGASGEIWSIFYKPSTS
ISIFKKKLKGQSQQDDRNPLVSD
Download sequence
Identical sequences 10141.ENSCPOP00000010643 ENSCPOP00000010643 ENSCPOP00000010643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]