SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010649 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010649
Domain Number 1 Region: 134-254
Classification Level Classification E-value
Superfamily EF-hand 3.97e-36
Family Osteonectin 0.0085
Further Details:      
 
Domain Number 2 Region: 223-315
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.88e-28
Family Thyroglobulin type-1 domain 0.00073
Further Details:      
 
Domain Number 3 Region: 71-117
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000129
Family Ovomucoid domain III-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010649   Gene: ENSCPOG00000011838   Transcript: ENSCPOT00000011953
Sequence length 370
Comment pep:known_by_projection scaffold:cavPor3:scaffold_1:52002699:52230392:1 gene:ENSCPOG00000011838 transcript:ENSCPOT00000011953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDYFRTWSPGKPFDLALDPAKDPCLKTKCSRHKVCISQDSQTAVCISHRRLTHSMKDAGV
GHKQWRALAAPSCSLCPMVSTSPVCGSDGHSYSSQCKLEYQACVLGKQISVKCEGRCPCP
ADKSTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKSLLRPERSRFDTSIL
PICKDSLGWMFNRLDTNYDLLLDQTELGSIYLDKNEQCTKAFFNSCDTYKDSLISNNEWC
YCFQRQQDPPCQTELSNIPKRQGVKKLLGQYIPLCDEDGYYKPTQCHGSIGQCWCVDRYG
NEVIGTRINGVATCALDFEISGDFASGDLHEWTDDEDEAEDIMNDKEEIEDDDEEEGDDD
DGGDEHDGYI
Download sequence
Identical sequences ENSCPOP00000010649 10141.ENSCPOP00000010649 ENSCPOP00000010649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]