SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010678 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010678
Domain Number 1 Region: 24-118
Classification Level Classification E-value
Superfamily HesB-like domain 8.11e-29
Family HesB-like domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010678   Gene: ENSCPOG00000011872   Transcript: ENSCPOT00000011987
Sequence length 129
Comment pep:known_by_projection scaffold:cavPor3:scaffold_11:15730448:15747785:1 gene:ENSCPOG00000011872 transcript:ENSCPOT00000011987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLQDKPEHVGLKVGVRTRGCNGL
SYTLEYTKTKGDSDEEVVQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT
CGCGESFNI
Download sequence
Identical sequences A0A286XJK8
10141.ENSCPOP00000010678 ENSCPOP00000010678 XP_003475112.1.53824 ENSCPOP00000010678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]