SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010695 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010695
Domain Number 1 Region: 35-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000779
Family V set domains (antibody variable domain-like) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010695   Gene: ENSCPOG00000011889   Transcript: ENSCPOT00000012004
Sequence length 224
Comment pep:known_by_projection scaffold:cavPor3:scaffold_80:4334435:4337505:-1 gene:ENSCPOG00000011889 transcript:ENSCPOT00000012004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGTGNFQALPATILLFLLSAACLGPGCQATLWVENGPTSVTVSPGDEARLQCRNNGNN
SKVTWWHILQGNYTWHPKFLGHTNGSEGEWIISNVNKSHGGIYRCRVEEKGTSLHSCGTY
LRVREPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKFGVDPRDDY
EDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLHIGDVQLEKP
Download sequence
Identical sequences H0VK82
ENSCPOP00000010695 XP_003464594.1.53824 10141.ENSCPOP00000010695 ENSCPOP00000010695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]