SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010702 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010702
Domain Number 1 Region: 146-461
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.03e-127
Family Transglutaminase core 0.0000000000312
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily E set domains 1.47e-42
Family Transglutaminase N-terminal domain 0.00000141
Further Details:      
 
Domain Number 3 Region: 472-588
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 7.59e-31
Family Transglutaminase, two C-terminal domains 0.00000284
Further Details:      
 
Domain Number 4 Region: 589-689
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.49e-29
Family Transglutaminase, two C-terminal domains 0.00000432
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010702   Gene: ENSCPOG00000011896   Transcript: ENSCPOT00000012011
Sequence length 690
Comment pep:known scaffold:cavPor3:scaffold_45:4541716:4573012:-1 gene:ENSCPOG00000011896 transcript:ENSCPOT00000012011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDLILERCDLQLEVNGRDHRTADLCRERLVLRRGQPFWLTLHFEGRGYEAGVDTLTFN
AVTGPDPSEEAGTMARFSLSSAVEGGTWSASAVDQQDSTVSLLLSTPADAPIGLYRLSLE
ASTGYQGSSFVLGHFILLYNPWCPADAVYMDSDQERQEYVLTQQGFIYQGSAKFINGIPW
NFGQFEDGILDICLMLLDTNPKFLKNAGQDCSRRSRPVYVGRVVSAMVNCNDDQGVLQGR
WDNNYSDGVSPMSWIGSVDILRRWKDYGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
FNSAHDQNSNLLIEYFRNESGEIEGNKSEMIWNFHCWVESWMTRPDLEPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGHLNVKYDAPFVFAEVNADVVNWIRQKDGSLRKSINHLV
VGLKISTKSVGRDEREDITHTYKYPEGSEEEREAFVRANHLNKLATKEEAQEETGVAMRI
RVGQNMTMGSDFDIFAYITNGTAESHECQLLLCARIVSYNGVLGPVCSTNDLLNLTLDPF
SENSIPLHILYEKYGDYLTESNLIKVRGLLIEPAANSYVLAERDIYLENPEIKIRVLGEP
KQNRKLIAEVSLKNPLPVPLLGCIFTVEGAGLTKDQKSVEVPDPVEAGEQAKVRVDLLPT
EVGLHKLVVNFECDKLKAVKGYRNVIIGPA
Download sequence
Identical sequences H0VK88
ENSCPOP00000010702 ENSCPOP00000010702 10141.ENSCPOP00000010702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]