SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010846 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010846
Domain Number 1 Region: 218-467
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.19e-88
Family Eukaryotic proteases 0.0000522
Further Details:      
 
Domain Number 2 Region: 121-227
Classification Level Classification E-value
Superfamily SRCR-like 6.15e-17
Family Hepsin, N-terminal domain 0.094
Further Details:      
 
Domain Number 3 Region: 87-125
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000484
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010846   Gene: ENSCPOG00000012057   Transcript: ENSCPOT00000012173
Sequence length 471
Comment pep:known_by_projection scaffold:cavPor3:scaffold_90:2583022:2599074:-1 gene:ENSCPOG00000012057 transcript:ENSCPOT00000012173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVEVEAEPGLRGPEIVTMGENDPPAAEAPFSFRSLFGLDDLKISPMAPDADAVAAQILSL
LPLKFFPIIIVGIIALILALAIGLGVHFDCSGKYRCRSSLKCIELTARCDGVSDCKDGED
EYRCVRVSGQSAVLQVFVAAAWRTMCTDDWKGGYARVACAQLGFPSYIGSGDLRVDLLEP
QFQGDFVSINHLLPDDKVTELHHSVYVREGCTSGRVVTLKCMACGLRTGYGARIVGGNES
SLAQWPWQVSLQFQGYHLCGGSVITPLWIVTAAHCVYDLYLPKSWTIQVGLVSLLDSPAP
SHLVEKIIYHSKYKPKRLGNDIALMKLAGPLAFHETVQPVCLPNSEENFPDGKVCWTSGW
GATEDGAGDASPVLNHAAVPLISNKLCNHREVYGGIVAPSMLCAGYLKGGVDSCQGDSGG
PLVCQQSRLWKLVGATSFGIGCADVNKPGVYTRITSFLDWIHEQMERDLKT
Download sequence
Identical sequences ENSCPOP00000010846 ENSCPOP00000010846 10141.ENSCPOP00000010846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]