SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010985 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010985
Domain Number 1 Region: 540-586
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000484
Family TSP-1 type 1 repeat 0.00053
Further Details:      
 
Domain Number 2 Region: 119-152
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000589
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 59-107
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000602
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000010985
Domain Number - Region: 495-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000565
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010985   Gene: ENSCPOG00000012214   Transcript: ENSCPOT00000012330
Sequence length 586
Comment pep:known_by_projection scaffold:cavPor3:scaffold_88:3366433:3401203:1 gene:ENSCPOG00000012214 transcript:ENSCPOT00000012330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMRMGVWTGRALAEVFLLSVALGCLSLPGSRGEKPVFLESSAVNKSRQARSVDIALMPID
CEQSSWISWTACDSCQKKRYRHRYLLKPSQFHGEPCTDSDKEVEDCIPSRPCRSQVRCEG
FLCAQTGRCINRRLLCNGDNDCGDQSDEANCRRVYKKCQHEMEQYWAIDHLASGINLFTN
SLEGPVLDHRHYAGGCSPHYILNTRFRKPYNVESYTPQTQGKYEFTLKEYESYTDFELNV
TEKATSKSSFSFGFKIPTVFELGINMETDQGKNYISRIKQFTDTKSKFLHARSDLDVAHY
KLKSRSLMLHYEFLQRVRQLPLEYSYGEYRDLFRDFGTHYITEAVLGGVYEYTLVMNQEA
MEQADYSLNDILDCAKHDFRIGGNIKGVSVKLGVSDDRCTKILSEIKDRNKRSTMVEDLV
VLVRGGASEHITTLAYKELPTAELMQEWGDAVQYNPAIVKVKVEPLYELVTASDFASSST
VRQHMKQALEEFQREVSSCHCAPCQGNGVPVLKGSHCECICPLGFQGPACEITYRKNVPI
NGNWNCWSTWSSCSGGVKTRYRQCNNPPPQGGGSPCRGPASETVPC
Download sequence
Identical sequences ENSCPOP00000010985 10141.ENSCPOP00000010985 ENSCPOP00000010985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]