SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011023 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000011023
Domain Number - Region: 72-108
Classification Level Classification E-value
Superfamily SET domain 0.000139
Family Viral histone H3 Lysine 27 Methyltransferase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011023   Gene: ENSCPOG00000012256   Transcript: ENSCPOT00000012372
Sequence length 121
Comment pep:novel scaffold:cavPor3:scaffold_100:1932825:1933187:-1 gene:ENSCPOG00000012256 transcript:ENSCPOT00000012372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAYLFTGNECVYGNYPELSLEEMPDADGVARASSLNVQEPCSPATSSEAFTPKESSPYRA
PIYIPDDIPIPAEFELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDPSYGWEV
R
Download sequence
Identical sequences ENSCPOP00000011023 10141.ENSCPOP00000011023 ENSCPOP00000011023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]