SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011052 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011052
Domain Number 1 Region: 151-232
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.18e-20
Family Complement control module/SCR domain 0.0000056
Further Details:      
 
Domain Number 2 Region: 92-152
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000945
Family Complement control module/SCR domain 0.0000324
Further Details:      
 
Domain Number 3 Region: 27-101
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000057
Family Complement control module/SCR domain 0.0000681
Further Details:      
 
Domain Number 4 Region: 1-35
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000347
Family Complement control module/SCR domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011052   Gene: ENSCPOG00000012289   Transcript: ENSCPOT00000012405
Sequence length 232
Comment pep:known_by_projection scaffold:cavPor3:scaffold_65:7343355:7353019:1 gene:ENSCPOG00000012289 transcript:ENSCPOT00000012405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YYLNGTNAARCTEEGKWSPELPVCAPITCPPPTVPKFAKLKMYKPSAGNYSLYQDTAVFD
CLPHHAIFGNDTVTCTAHGNWTELPECREVKCPFPLRPENGFVNYPAKPLLFYKDKATYG
CHDTYTLDGPEEVECTKLGNWSAQPSCKASCKLSVRKATVLYQGERVKLQERFKNGMLHG
DKVSFFCKNKEKKCSYTEEAQCMDGTIEIPKCFKEHSSFAFWKTDAWDVKPC
Download sequence
Identical sequences ENSCPOP00000011052 10141.ENSCPOP00000011052 ENSCPOP00000011052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]