SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011403 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011403
Domain Number 1 Region: 2-125
Classification Level Classification E-value
Superfamily Histone-fold 1.68e-42
Family Nucleosome core histones 0.00000336
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011403   Gene: ENSCPOG00000012677   Transcript: ENSCPOT00000012798
Sequence length 127
Comment pep:novel scaffold:cavPor3:scaffold_6:24664041:24664424:1 gene:ENSCPOG00000012677 transcript:ENSCPOT00000012798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARTKQTAHKSTGGKVRRKQLATKATRKSAPSTGGVKKPHRYRPGTEALREIRRFQKSTE
LLICETSQDFKTDLRFQSAAIGALQEASEAYLVGLIEDTNLCAIHAKRVTIMPKDIQLAR
HIRGEHA
Download sequence
Identical sequences ENSCPOP00000011403 ENSCPOP00000011403 XP_003477289.1.53824 10141.ENSCPOP00000011403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]