SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011409 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011409
Domain Number 1 Region: 2-244
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.75e-92
Family Inorganic pyrophosphatase 0.000000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011409   Gene: ENSCPOG00000012683   Transcript: ENSCPOT00000012804
Sequence length 247
Comment pep:known_by_projection scaffold:cavPor3:scaffold_43:5607266:5658730:-1 gene:ENSCPOG00000012683 transcript:ENSCPOT00000012804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNLHHMVVEVPRWTNAKMEIATSEPLNPIKQDMKRDKPRYVANVFPHKGYIWNYGALPQT
WEDPNHRSKHTGCCGDNDPIDVCEIGSKVLSRGEVVPVKILGILALLDQGETDWKLIAIN
ANDPEAHKFHDIDDVEKFKPGYLEATIHWLKFYKVPEGKPQNCFFYDGKFKDKAFALDVI
KSTHDCWKALHMKTCDAGPINCTNSQVHDSPFRCTQEEARAMVESVSPASPRIESDGEEQ
VWHFLGK
Download sequence
Identical sequences ENSCPOP00000011409 ENSCPOP00000011409 10141.ENSCPOP00000011409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]