SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011477 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011477
Domain Number 1 Region: 79-235,325-585
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.18e-67
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.011
Further Details:      
 
Domain Number 2 Region: 686-807
Classification Level Classification E-value
Superfamily PKD domain 1.01e-19
Family PKD domain 0.00016
Further Details:      
 
Domain Number 3 Region: 820-889
Classification Level Classification E-value
Superfamily PKD domain 0.0000458
Family PKD domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011477   Gene: ENSCPOG00000012755   Transcript: ENSCPOT00000012878
Sequence length 1094
Comment pep:known_by_projection scaffold:cavPor3:scaffold_11:7844887:8335340:1 gene:ENSCPOG00000012755 transcript:ENSCPOT00000012878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RALSLERARGTKTAAAVAGRSGRRRRSEADQETAEHGVDASRSPRSVLKDGGQSEPGTRE
RDPDKATRFRMEELRLTSTTFALTGDSAHNQAMVHWSGHNSSVILILTKLYDYNLGSITE
SSLWRSTDYGTTYEKLNDKVGLKTILSYLYVCPTNKRKIMLLTDPEIESSLLISSDEGAT
YQKYRLNFYIQSLLFHPKQEDWILAYSQDQKLYSSTEFGRRWQLVQEGVVPNRFYWSVMG
SNKEPDLVHLEARTVDGHSQYLTCRMQNCTDTNKNKPFPGYIDHDSLIVQDDYVFVQLTS
GGRPHYYVSYHRNAFAQMKLPKYALPKDMHVISTDENQVFAAVQEWNQNDTYNLYISDTR
GIYFTLALENVQSSRGPEGNVMIDLYEVAGIKGMFLANKKIDNQVKTFITYNKGRDWRLL
QAPDTDLRGDPVHCLLPYCSLHLHLKVSENPYTSGIIASRDTAPSIIVASGNIGSELSDN
DISMFVSSDAGNTWRQIFEEEHSILYLDQGGVLVAMKHTSLPIRHLWLSFDEGRSWSKYS
FTSIPLFVDGVLGEPGEETLIMTVFGHFSHRSEWQLVKVDYKSIFDRRCAEEDYTPWHLY
NQGEACIMGAKRKYKKRKSERKCMQGKYAGAMESEPCVCTEADFDCDYGYERHSNGQCLP
AFWFNPSSLSKDCSVGQSYLNSTGYRKVVSNNCTDGVREQYTAKPQKCPGKAPRGLRILT
ADGKLTAEQGHNVTLLVQLEEGDVQRTIIQVDFGDGIAVSYVNLSSMEDGIKHVYQNVGI
FRVTVQVDNSLGSDSAVLYLHVTCPLEHVHLSLPFVTTKNKEVNATAVLWPSQVGTLTYV
WWYGNNTEPLITLEGSVSFRFTSEGMNTITVQVSAGNAILQDTKTIAVYEEFRSLRLSFS
PNLDDYNPDIPEWRRDISRVIRKSLVEATGVPSQHILVAVLPGLPTAAELFVLPYQDPAG
ENRRSPEDLEQISEVLIHKLNQNAVHFELKPGVQVLVHAAHLTAAPLVDLTPTHSGSAML
MLLSVVFVGLAVFVIYKFKRKIPGINVYAQMQNEKEQEMISPDSHIETRPSVPHTELRRP
GQLRDEKVESQLIG
Download sequence
Identical sequences 10141.ENSCPOP00000011477 ENSCPOP00000011477 ENSCPOP00000011477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]