SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011480 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000011480
Domain Number - Region: 8-47
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0182
Family Snake venom toxins 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011480   Gene: ENSCPOG00000012758   Transcript: ENSCPOT00000012881
Sequence length 52
Comment pep:known_by_projection scaffold:cavPor3:scaffold_19:20351403:20351558:1 gene:ENSCPOG00000012758 transcript:ENSCPOT00000012881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFSSTSSGQSMYYYSKLSCRSNCENIIFLDFNKKTEVLCCKHSNYCNLPEGL
Download sequence
Identical sequences ENSCPOP00000011480 10141.ENSCPOP00000011480 ENSCPOP00000011480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]