SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011553 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011553
Domain Number 1 Region: 725-782
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000229
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 28-69
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000366
Family Somatomedin B domain 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000011553
Domain Number - Region: 64-136
Classification Level Classification E-value
Superfamily E set domains 0.00266
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011553   Gene: ENSCPOG00000012834   Transcript: ENSCPOT00000012959
Sequence length 823
Comment pep:known_by_projection scaffold:cavPor3:scaffold_4:8516756:8523803:1 gene:ENSCPOG00000012834 transcript:ENSCPOT00000012959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLALLPWVLLLLATVPGPGPRPTADAQDSCSLRCGNQNGTCSCHPTCSGLGTCCPDFRD
FCLEISPFSGSMMGGKDFVVRHFKWSTHTEGVICRFKESIQILGHVDSLGQVHCVSPLLY
ETGRIPFTISMDNGRSFLRAGTWLAVHPNKVSQSEKGQLVNETRWQYYGTPGTTTGNLSV
TWDTSVLSTQTVNIELWGYEETGTPYSGNWIAKWSYLYSLATNAPNSGFFTFIPEPALAS
YQKWRVGALRITASKHYQGEKDVLAIWTNEHALAWHLGDDFRKDSVSWARAQCLDWEELE
DNLPDFLKELPDCPCNLVQARADTGRFFTDYGCDIEQNSTCTYHPGAVHCVRSVQASPRF
ASGQQCCYRKDGSQLLTADSIGGSTPDRGHDWGAPPYRTPPRVPTLSHWLYDVMSFYYCC
LWAPECSRYMQRRPSSDCRTYRPPRLASVFGDPHFVTFDGTKFTFNGRGEYVLLEGEADG
KDLRVQARAEPTTLTSGTQARGTGLTAVVVQEDSSDVVEARLAHRPGVLEVLLNSEVLSF
AEQSWMDLNGLFLSVAGEDKVSIMLSSGAGLEVSIQGPFLSVAVLLPEKFQNHTRGLLGT
LNNNPADDFTLRSGMVLPSNASAQELFQFGAEWAVHNSSSLFTYDSWSLVYNFLYRPKHD
STFKPLFSDEIVLSPDQAEEVAKLCGDDHFCKFDVAVTGNLIVGNVTRAAHQMHQERLQS
LQPVVSCGWLAAPSNGHKEDFKYLVGSTVRFHCESGYSLAGADTSTCQADGTWSAPTPEC
QLGRSYTVLLSIIFGGLAVVALVAIIYLLLRRRKNMNLWRSHP
Download sequence
Identical sequences H0VMC5
ENSCPOP00000011553 XP_003478008.2.53824 10141.ENSCPOP00000011553 ENSCPOP00000011553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]