SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011590 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011590
Domain Number 1 Region: 1-84,274-582
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 5.89e-68
Family Integrin alpha N-terminal domain 0.0000309
Further Details:      
 
Domain Number 2 Region: 104-298
Classification Level Classification E-value
Superfamily vWA-like 4.31e-51
Family Integrin A (or I) domain 0.000000856
Further Details:      
 
Domain Number 3 Region: 582-728
Classification Level Classification E-value
Superfamily Integrin domains 1.94e-30
Family Integrin domains 0.0041
Further Details:      
 
Domain Number 4 Region: 729-742,771-893
Classification Level Classification E-value
Superfamily Integrin domains 7.85e-18
Family Integrin domains 0.0047
Further Details:      
 
Domain Number 5 Region: 911-1091
Classification Level Classification E-value
Superfamily Integrin domains 0.000000000314
Family Integrin domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011590   Gene: ENSCPOG00000012877   Transcript: ENSCPOT00000013002
Sequence length 1134
Comment pep:known_by_projection scaffold:cavPor3:scaffold_0:87928646:87968530:-1 gene:ENSCPOG00000012877 transcript:ENSCPOT00000013002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVVGAPLETNGHQKTGDIYKCPVIQGNCTKLNLGRVTLSNVSERKDNMRLGLSLATNPKD
NSFLACSPLWSHECGSSYYTTGMCSRVNANFRFSKTVAPALQRCQTYMDIVIVLDGSNSI
YPWVEVQHFLINILKKFYIGPGQIQVGVVQYGEDVVHEFHLNDYRSVKDVVEAASHIEQR
GGTETRTAFGIEFARSEAFQKGGRKGAKKVMIVITDGESHDSPDLERVIQQSERDNVTRY
AVAVLGYYNRRGINPETFLNEIKYIASDPDDKHFFNVTDEAALKDIVDALGERIFSLEGT
NKNETSFGLEMSQTGFSSHVVEDGVLLGAVGAYDWTGAVLKETSGGKVIPLRESYLKEFP
EELKNHGAYLGYTVTSVVSSRQGRVYVAGAPRFNHTGKIILFTMHNNRSLTIHQALRGEQ
IGSYFGSEITSVDVDDDGVTDVLLVGAPMYFSEGRERGRVYVYQLRQSRFVYNGTLRDSH
GYQNARFGACIAAVRDLNQDSYNDVVVGAPLEDGHQGAIYVFRGAPGGILKTPSQKIIAS
MLAPGLQYFGCSIHGQLDLNEDGLVDLAVGALGSTVILWARPVVQINASLRFEPPRINIF
HKDCKRSGRDATCLAAFLCFTPVFLAPYFQTADVGIRYNATMDERRYMPRAHLDEGSDQF
TNRAALLSAGQEHCQRLSFHVLDTADYVKPVAFSVEYSLEDPENGPVLDDGWPTTLRVSV
PFWNGCNEDEHCIPDLLLDARSDLPTALEYCQRVLRKPTQHCSAYTLSFDTTVFIIESTR
RRVAVEATLGNRGENAYSAVLNISQSPNLQFASLVQRDDLDNSIECVNEERGLHKRVCNV
SYPFFRAQAQVVAFRLEFEFSKSVFLNYLEIQLSSGSDSDEQDSTKEDNTALLRFHLKYE
ADVLFTRSSSLSHYEVKANSSLESYGGLGPPFHCVFKVQNLGFFPIHGVTMKITIPVATR
GGNRLLVLRDFFTDQVNTSCNIWGNTTEYRATPMDEDLSQTLRLNHSNADVVSINCHVRL
APNQELSFHLLGNLWLRSLKALKFRSLKITMNSALQRQFHSPFIFREEDPSRQVTFDISK
QEDSQVSIWIILGSTLGGLLLFALLVLALWKLGFFKSAKRKREPGADPRPKVLE
Download sequence
Identical sequences 10141.ENSCPOP00000011590 ENSCPOP00000011590 ENSCPOP00000011590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]