SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011658 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011658
Domain Number 1 Region: 35-124
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000889
Family Integrin domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011658   Gene: ENSCPOG00000012949   Transcript: ENSCPOT00000013074
Sequence length 126
Comment pep:known scaffold:cavPor3:scaffold_4:46191798:46193199:1 gene:ENSCPOG00000012949 transcript:ENSCPOT00000013074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLELPVKYAVYLIVTSGEASTTYLNFTTSEKTIQTMKHQYKFTNLGKRSLPISVVFWVPV
RLNNEIVWDRPQVTFSPNLSSACNTEERSPPHSDFLAELEKTHVLNCSIAVCQRIACDIP
YFNIQE
Download sequence
Identical sequences P11578
ENSCPOP00000011658 ENSCPOP00000011658 10141.ENSCPOP00000011658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]