SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011687 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011687
Domain Number 1 Region: 209-496
Classification Level Classification E-value
Superfamily Kelch motif 1.96e-38
Family Kelch motif 0.0057
Further Details:      
 
Domain Number 2 Region: 1417-1633
Classification Level Classification E-value
Superfamily Kelch motif 1.96e-29
Family Kelch motif 0.02
Further Details:      
 
Domain Number 3 Region: 34-140
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-24
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 4 Region: 1689-1811
Classification Level Classification E-value
Superfamily Kelch motif 0.0000000000615
Family Kelch motif 0.016
Further Details:      
 
Domain Number 5 Region: 1124-1172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family Laminin-type module 0.0055
Further Details:      
 
Domain Number 6 Region: 1005-1040
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000269
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 7 Region: 1076-1124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000105
Family Laminin-type module 0.032
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000011687
Domain Number - Region: 2162-2212
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000117
Family Laminin-type module 0.019
Further Details:      
 
Domain Number - Region: 2090-2125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000556
Family EGF-type module 0.076
Further Details:      
 
Domain Number - Region: 2256-2291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00363
Family Laminin-type module 0.023
Further Details:      
 
Domain Number - Region: 1211-1314
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00785
Family Spermadhesin, CUB domain 0.0086
Further Details:      
 
Domain Number - Region: 507-533
Classification Level Classification E-value
Superfamily Kelch motif 0.0327
Family Kelch motif 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011687   Gene: ENSCPOG00000012979   Transcript: ENSCPOT00000013105
Sequence length 2737
Comment pep:known_by_projection scaffold:cavPor3:scaffold_80:3932546:3973265:-1 gene:ENSCPOG00000012979 transcript:ENSCPOT00000013105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALARALALTLALAVLVLLSPLALAGDCKGQRQVLREAPGFVTDGAGNYSVNGNCEWLIE
APSPQHRILLDFLFLDTECTYDYLFVYDGDSPRGPLLASLSGSTRPPPIEASSGKMLLHL
FSDANYNLLGFNASFRFSLCPGGCQNHGQCQPAGVCACEPGWGGPDCSLQECSAYCGSHG
TCASPLGPCRCEPGFLGRACDLHLWENQGAGWWHNVSAGDPAFSARIGAAGAFLSPPGLL
AVFGGQDLNKALGDLVLYNFSANTWERWDLSPAPAARHSHVSVAWAGSLVLMGGELANGS
LTNDVWVFSPLGGGHWELLAPAASSSSGPPGLAGHAAALVDDVWLYVSGGRTQHDLFSSD
LFRFCLGGTSRGYWEQVIPAGGRPPAATGHSMVFHAPSRALLVHGGHRPSTARFSVRVNS
TELFHVDRRVWTTLKGRDGLQGPRERAFHTASVLGNYMVVYGGNVHTHYQEEKCYEDGIF
FYHLGCHQWVSGAELAPPGTPEGRAAPPSGRYSHVAAVLGGSVLLVAGGYSGRPRGDLMA
YKVPPFVFQAPAPDYHLDYCSMYTDHSVCSRDPECSWCQGACQAAPPPGTSSGACPAASC
LGLGRLLGDCQACLAFSSPTAPPRGPGTLGWCVHNESCLPRPEQARCRGEQISGTVGWWG
PVPVFVTSLEACVTQSFLPGLHLLTFQQPPNASQPDKEEVGRWVAQQEKETRRLQRPGSA
RLFPLPGRGHKYAVEIQGQLNGSAGPGHSELTLLWDRTGVPGGSEISFFFLEPYRSSACA
SYSSCLGCLADQGCGWCLSSATCHLRQGGAHCEDDRAGGSLLVLVPALCPLCEEHRDCHA
CTQDSFCEWHQSVSRKGDAACSRRGRGRGALKSQEECPPLCSQRLTCEDCLANSSQCAWC
QSTHTCFLFAAYLARYPHGGCRGWDDSVHSEPRCRSCNGFLTCHECLQSHECGWCGNEDN
PTLGRCLQGDFSGPLGGDNCSLWIGKGLGLPVALPARWAYARCPDVDECRLGLARCHPRA
SCLNTPLSYECQCQRGYQGDGITHCNRTCLEDCGHGVCSGPPDFTCVCELGWTSDCGCNF
HSHCHKRGPGFCDECQDWTWGEHCERCRPGSYGNATGSGGCRPCQCNGHGDPRHGHCDNL
SGLCFCQDHTEGAHCQLCSPGYYGDPRAGGSCFRECGGRALLTNVSSVALGSRRFGGLLP
PGGGAARAGPGLSYCVWVVSATEELQPCAPGTLCPPLTLTFSPDSSTPCTLSYVLAFDGF
PRFLDTGVVQSDRSLIAAFCGQRRDRPLTVQALSGLLVLHWEANGSSSWGFNASVGSARC
GSGGPGSCPVPQECVPQDGAAGAGLCRCPQGWAGPHCRMALCPENCNAHTGAGICNQSQG
VCICAEGFGGLDCATKLDGGQLVWETLMDSRLSSDTASRFLHRLGHTMVEGPDATLWMFG
GLGLPQGLLGNLYRYSVSERRWTQMLAGAEDGGPGPSPRSFHAAAYVPAGRGAMYLLGGL
TAGGVTRDFWVLNLTTLQWRQEKVPQSVELPSVAGHTLTARRGLSLILVGGYSPENGFNQ
QLLEYQLATGTWLSGAQSGTPPTGLYGHSAVYHEATDSLYVFGGFRFHVELAAPSPELYS
LHCPDRTWSLLAPSQGAKTDGCRQNRVSIWSLGQVLGEQHRLWGLQGFREKERAPWVALR
DPGGTRGREQPRPRLFHASALLGDTMVVLGGRSDPDEFSSDVLLYQVNCNSWLLPDLTRS
ASVGSPMEESVAHAVAAVGSRLYISGGFGGVALGRLLALTLPPDPCRLLPSPEACNQSGA
CTWCHGACLSGDQAHRLGCGGSPCSPMPRSPEECRRLRTCSECLARHPRTLQPGDGEASA
PRCKWCTNCPEGACIGRNGSCTSENDCRINQREVFWAGNCSEAACGAADCEQCTREGKCM
WTRQFKRTGETRRILSVQPTYDWTCFSHSLLNVSPMPVESSPPLPCPTPCHLLPNCTSCL
DSKGADGGWQHCVWSSSLQQCLSPSYLPLRCMAGGCGRLLRGPESCSLGCAQATQCALCL
RRPHCGWCAWGGQDGGGHCMEGGLSGPRDGLTCGGSGASWAFLSCPPEDECANGHHDCNE
TQNCHDQPHGYECSCKMGYTMDNVTGLCRPVCAQGCVNGSCVEPDHCRCHFGFVGRNCST
ECRCNRHSECAGVGARDHCLLCRNHTKGSHCEQCLPLFVGSAVGGGTCRPCHAFCRGNSH
VCVSRKELEMARREPEKYSLDPDQIENWVTEGPSEDEAVCVNCQNNSYGDKCESCLHGYF
LLDGKCTKCQCNGHADTCNEQDGTGCPCQNNTETGTCQGSSPSDRRDCYKYQCAKCRESF
HGSPLGGQQCYRLISVEQECCLDPTSQTNCFHEPKRRALGPGRTVLFGVQPKFTNVDIRL
TLDVTFGAVDLYVSTSYDTFVVRVAPDTGIHTVHIQPPPPPPPPLPPADGGPRVAGDPGG
PGAGSGPGTPPEPRVREVWPRGLITYVTVTEPSAVLVVRGVRDRLVITYPHEHHALKSSR
FYLLLLGVGDPSGPGANGSADSQGLLFFRQDQAHIDLFVLLWKAKQALDQRQEQRRHLQE
MTKMASRPFAKVTVCFPPDPTAPTPAWKPAGLPPPAFRRSEPFLAPLLLTGAGGPWGPMG
GGCCPPAIPATTTGLRAGPITLEPTEDGMAGVATLLLQLPGGPHAPNGACLGSALVTLRH
RLHDYCGGGGSAGGSGHGAGVGRKGLLSQDNLTSMSL
Download sequence
Identical sequences ENSCPOP00000011687 ENSCPOP00000011687 10141.ENSCPOP00000011687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]