SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011814 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011814
Domain Number 1 Region: 640-765
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.54e-19
Family N-acetyl transferase, NAT 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011814   Gene: ENSCPOG00000013124   Transcript: ENSCPOT00000013251
Sequence length 781
Comment pep:known_by_projection scaffold:cavPor3:scaffold_8:8397642:8417446:-1 gene:ENSCPOG00000013124 transcript:ENSCPOT00000013251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSVHLSGLLSRHDDEATRTSTSEGLEEGEVEGETLLIVESEDQASVDLSHDQSGDSLN
SDEGDVSWLEEQLSYFCDKCQKWIPASQLREQLSYLKGDNFFRFTCADCSADGKEQYERL
KLTWQQVVMLAMYNLSLEGSGRQGYFRWKEDICAFIEKHWAFLLGSRKKTSTWWSTVAGC
LSVGSPMYFRSGAQEFGEPGWWRLVHNKPPTLKPEGEKLSSSSLKARASKPVLDPIITVE
GLRKRAGRNPVESAMELKEKRSRTQEAKDIRRAQKEAASFLDRSPASTPVKFASRARRPD
VVLERGEVIDFASLSSSDRTPLTSPSPSPSLDFSAPGTPASHSATPSLLSEADLIPDAMP
PQALFHDDDELDGDGDIDPGVEDPPPSLGPVALGQGSAGRKKVRAPEHIKQEVDSEEEKP
DRADLDSEDTDSSASLQPRVRDKRRPPLQKDTRPQGPRCMPASIYEEKLLLRRLEACPGA
VAMTPEARRLKRKLLVRQAKRDRGLPLFDLDQMVSAALLLVDGIYGAKDGGLSRLPAGQA
TYRTTCQDFRILDRYQTALPSRKGFRHQTSKFLYRLVGSEDLALDQSIVSPYTSRILKPY
IRRDYETKPPKLQLLSQIRSYLHRSDPHWTPEPDAPLDYCYVRPNHIPTINSMCQEFFWP
GIDLSECLQYPDFSVVVLYKKVIIAFGFMVPDVKYNEAYISFLLVHPEWRRAGIATFMIY
HLIQTCMGKDVTLHVSASNPAMLLYQKFGFKTEEYVLDFYDKYYPLESTECKHAFFLRLR
R
Download sequence
Identical sequences H0VN08
XP_003476555.1.53824 ENSCPOP00000011814 ENSCPOP00000011814 10141.ENSCPOP00000011814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]