SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011856 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011856
Domain Number 1 Region: 16-93
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000000000118
Family Snake venom toxins 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011856   Gene: ENSCPOG00000013169   Transcript: ENSCPOT00000013296
Sequence length 121
Comment pep:known_by_projection scaffold:cavPor3:scaffold_17:35051751:35052592:-1 gene:ENSCPOG00000013169 transcript:ENSCPOT00000013296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQPQRAPIVLILEGLPAGAALQCYSCTAQVNNRDCQKVQNCSHTDTYCWTSRVGAIGVLE
FISKGCTSDCVDDSDNYYFGKKNITCCSTDLCNASRAYALKPTTTLGLLTALIVPLLWGP
G
Download sequence
Identical sequences ENSCPOP00000011856 ENSCPOP00000011856 10141.ENSCPOP00000011856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]