SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011961 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011961
Domain Number 1 Region: 2894-3074
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.09e-36
Family Laminin G-like module 0.0000051
Further Details:      
 
Domain Number 2 Region: 2704-2883
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.7e-34
Family Laminin G-like module 0.0000414
Further Details:      
 
Domain Number 3 Region: 2285-2475
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.2e-33
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 2467-2665
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.44e-29
Family Laminin G-like module 0.0084
Further Details:      
 
Domain Number 5 Region: 2117-2285
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.3e-27
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 779-831
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000151
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 7 Region: 829-882
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000787
Family Laminin-type module 0.0017
Further Details:      
 
Domain Number 8 Region: 250-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 9 Region: 722-773
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000162
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 10 Region: 1383-1434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000204
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 11 Region: 882-928
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000446
Family Laminin-type module 0.0045
Further Details:      
 
Domain Number 12 Region: 1024-1072
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000837
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 13 Region: 1490-1537
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000725
Family Laminin-type module 0.0091
Further Details:      
 
Domain Number 14 Region: 377-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000279
Family Laminin-type module 0.055
Further Details:      
 
Domain Number 15 Region: 1441-1492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000745
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 16 Region: 449-485
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000179
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 17 Region: 52-141
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000234
Family APC10-like 0.043
Further Details:      
 
Domain Number 18 Region: 307-365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000254
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 19 Region: 931-980
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000257
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 20 Region: 684-724
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family Laminin-type module 0.066
Further Details:      
 
Domain Number 21 Region: 975-1022
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family Laminin-type module 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000011961
Domain Number - Region: 1340-1365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00279
Family Laminin-type module 0.084
Further Details:      
 
Domain Number - Region: 1089-1132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0391
Family Laminin-type module 0.02
Further Details:      
 
Domain Number - Region: 1594-1689
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0497
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011961   Gene: ENSCPOG00000013286   Transcript: ENSCPOT00000013415
Sequence length 3076
Comment pep:known_by_projection scaffold:cavPor3:scaffold_82:3983235:4081913:1 gene:ENSCPOG00000013286 transcript:ENSCPOT00000013415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLFPAILNLATNAEISANATCGEKGPEMSCKLVEHVPGRRTRNAQCQLCDASSTNPKEHH
PISNAIDGTNNWWQSPSIQNGREYHWVTITLDLRQVFQVAYVIIKAANAPRPGNWILERS
VDGATFSPWQFYAISDSECLTRYNITPRRGPPTYRADDEVICTSYYSRLVPLEHGEIHTS
LINGRPSADDLSPRLLEFTSARYIRLRLQRIRTLNADLMTLSHLDPRDIDPIVTRRYYYS
IKDISVGGMCICHGHASSCPWDATTKRLQCQCEHNTCGESCDRCCPGYHQQPWRPGTVSS
GNTCEECNCHNKASDCYYDENIAKQKKSLDTSGQFQGGGVCIGCQQNTAGVNCETCVPGF
YRPHRVSPYEDEPCRPCDCDPVGSLSSDCVKDDLQSNLHHGVWPGQCPCKEGYGGERCDR
CQFGYKGFPSCVRCDCSPAGSVNDDPCAEPCLCKDNVEGEACDRCKPGFYNLQEKNPQGC
SECFCFGVSGVCDSLSWPLGQVNDMNGWLVTDLVSGRKIKSQQEAVGGRPQISISHAEVT
QRLGARYYWSAPEAYLGNKLTAFGGLLKYTVSYNIPVEAVEGDLMSHADVILKGNGLTLS
TQAEGLSLQPYQEYYNAVRLVPENFRDYGTKREIDRDQLMTVLANLTHLLIRANYNSANT
ALYRLDSVSLDIASPNAIDLTVATDVEHCECPQGYMGTSCESCQPGYYRVDGILFGGICQ
PCECHGHARECDARGICSGCTHNTTGDHCEQCLPGFYGMPSRGTPRDCQPCACPLATPSN
NFSPTCHLDEEEDVVCDQCAPGYAGTWCERCADGYYGNPTVPGGSCVPCDCSGNVDPSEP
GHCDSVTGQCLKCVGNTGGAHCERCADGFYGDAVTAKNCRACGCHEKGSLSGVCHPESGR
CDCRPHVTGQRCDQCLPGYYGLDTAPGCLACNCSATGSTSGDCTDLGQCRCLPGVTGRRC
DRCAHGFFSFREGGCTACDCAHTQNSCDPESGECICPPHTTGPKCEDCEAGHWGWDAEQG
CQACSCSSKGSTGSQCNLLSGQCPCKAEFGGQLCDQCSLGYRDFPDCVPCACDLRGTLAT
TCDLDLGVCSCAEDTGACSCKENVVGLQCSECRTSTYALRANDPRGCTPCFCFGLSNICV
ELEGYVRTPVTLSAHQPLLRVVSQSNVTGTTEGVYHQVPDVLLDAATVRQHVHTEPFYWR
LPEQFQGDQLLAYGGRLRYSVAFYASDGTGTFNLEPQVLIKGGRGRKQVIYTDAPAPENG
VWQLQEVGMKENFWKYFNSVSEEPVTRADFMSVLSSVEYILIKASYGHGLQQSRITNISM
EVGTEAGGQHPTGEAAALIEQCVCPPGTAGLSCQDCAPGFRRQKPPEGGGRESRLLLAPC
VPCTCNNHSAACDPETGKCLNCRDNTAGDHCELCTPGYYRKVTGTTLHCSPCACPHSPPA
SNFSPTCVSEVDGGFRCSACAVGYEGRYCERCSVGYYGNPGMLGGSCQKCICSPQGSVHS
NCDPLSGQCICKPGATGLQCDECQPRHLLVDSSCVSCDDECTGILLGDLDRVGDAILSVN
LTSVVPAPYGVLSNLENATRSLRESLLKENSQKNSAEIQLDGIAKLTDELQKQLTRVLPR
SQQAGRASEKILQGSRDLAVFIERLQENIREILEKATNLNQTVDENFQLPNSTLQNMRQS
IASLLEMIRKRQFTDLLHNTSRELAAAEDLLSAVQKDFQRPQKELQGLKDAAGHLLSKHT
AELQAAEELLSEAKARTEESARLLFLSEANLRDFSNKKLHLQEQQNVTSELVAEGRGLVD
AATAQADRLQDTLVQAERYRDELLLWAAKIRSHVDHLVMQMSERRMVDLVYRAEDHAAGL
QRSAGALDSGLESARHASLNATSAVHVHFNIQSLVEESKSLARAARKASREVRQDPHGHR
ESLVSSGKAAVQRSSGIRSDSGSLSSKQQGLTLKLSELKNTANRFQERAGRITQQTNNSL
LTLSATPKVLSCCLSLLRAQVPQSQLQDVPSDLPPVRNNSKSREKALAKPATSVIQETAE
AEAGECNSSMLGADATCSYCGVDTPPPRRGLSAEALRTLEENLSRTVRIKLLISQARKQA
ARIKVAVAADRDCIRAYQPQISSTNYNTLALNVKTREPDNLLFYLGSSAGADFLAVETRR
GKVAFLWDLGSGAARLELPDLRIDDDRWYSVHANRFGNTGSLSVKETSSTQEPRTKTSKS
PGTAKVLDVNNSTLMFVGGLGGQIKKSPAVKVTYFKGCMGEAFLNGHSVGLWNYVEREGR
CRGCFGSPQNEDSSFRFDGSGYSVVEKTMRATVTQIIMLFNTFSPHGLLLYLASNGTKDF
LSIELVHGRVRVMVDLGSGPLILTTDRRYNNGTWYKIAFQRNRKQGLLAVIDVYNTSDKE
TKQGEAPGAASDLNRLDKDPIYVGGLPLWRIPSLFNWKGVTSKSYVGCIKNLEISRSTFD
LLRNSYGVGKGCILEPIRSVSFLRGGFVELPPKPLLLESELLATFATKNSSGIILAAIGQ
DTERQGRRPTHVPFFAILLVDGHVEVHISFGDGTSLRRALVHAPSGTYGDGQEHSVSVVR
TQRIITVQLDEWSPVEMRLGPSAEGRTINTSALYVGGVPEGERTSMLRMRGPFHGCIRNL
VFNMDLLDFTSAVASEQVDLDSCQLAERPQPAPHSELPSQPRAVPRPAGPCPVSVMCDLS
QGQCAVDTSLQFISGAHQFGLSKNSHFVLPFDQSEVRKRLLVQLSMRTFASSGLVFYAAH
QNQVDHAVLQLHGGRLVFTFDLGRGRTRVSHPTPIDDGRWHLVKAEYSKRKGSLAVDGQE
APAVTAVGEGTSLDVEGKLYLGGLPQDYRPRSIGNITHSIPACIREVMVNNRPLNMDNLA
SAVAVGRCHVVAEEGTFFEGSGHAAVVREGYRVGSDLNITLEFRTSSENGVLLGISSAKV
DAIGLEIVSGQVLFHVNNGAGRITATFRPGGGSRLCDGKWHTLHASKSRHRLVLSVDGRS
VSAESPHRQSTSADTNDPIYVGGFPADVKQNCLTSRVPFRGCLRGLTLTRGPHVQALDFS
QAFELHGVSPNSCPGS
Download sequence
Identical sequences ENSCPOP00000011961 10141.ENSCPOP00000011961 ENSCPOP00000011961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]