SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012050 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012050
Domain Number 1 Region: 389-625
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.23e-37
Family Calponin-homology domain, CH-domain 0.0000852
Further Details:      
 
Domain Number 2 Region: 87-241,386-468
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.18e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.072
Further Details:      
 
Domain Number 3 Region: 784-817
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000609
Family LIM domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000012050
Domain Number - Region: 818-846
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000265
Family LIM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012050   Gene: ENSCPOG00000013387   Transcript: ENSCPOT00000013518
Sequence length 977
Comment pep:novel scaffold:cavPor3:scaffold_169:627154:688551:-1 gene:ENSCPOG00000013387 transcript:ENSCPOT00000013518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEERKHEAVNQAHVLFDRFVQATTCKGTLKAFQELCDHLELKPKDYRSFYHKLKSKLNYW
KAKALWAKLDKRGSHKDYKKGKACTNTKCLIIGAGPCGLRTAIDLSLLGAKVVVIEKRDA
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGAIDHISIRQLQLILLKVALILGIEIHVN
VEFQGLVQPPEDQENERIGWRALVHPKTHPVSEFEFEVIIGGDGRRNTLEGFRRKEFRGK
LAIAITANFINRNTTAEAKVEEISGVAFIFNQKFFQELREATGIDLENIVYYKDDTHYFV
MTAKKQSLLDKGVILHDYADTELLLSRENVDQEALLNYAREAADFSTQQQLPSLDFAINH
YGQPDVAMFDFTCMYASENAALVREQNGHQLLVALVGDSLLEPFWPMGTGIARGFLAAMD
SAWMVRSWSLGASPLEVLAERESIYRLLPQTTPENVSKNFSQYSINPVTRYPNININFLR
PSQVRHLYDTGETKDIHLEMENLVNSRTTPKLTRNESVARSSKLLSWCQRQTDGYAGVNV
TDLTMSWKSGLALCAIIHRYRPDLIDFDSLDEQNVEKNNQLAFDIAEKELGISPIMTGKE
MASVGEPDKLSMVMYLTQFYEMFKDSLSSTDTLDLNAEEKAVLIASTKSPISFLSKLGQT
ISRKRSPKDKKEKDLDGAGKRRKTSQSEEEEVSRGYRGERPTLVSTLTDRRMDVAIGNQN
KVKYMATQLLAKFEENAPAQSTGIRRQPTQERGVSQPSCHLPEQGRLAHIPQWKQGSMKK
EFPQNLGGSDTCYFCQKRVYVMERLSAEGKFFHRSCFKCEYCATTLRLSAYAYDIEDGKF
YCKPHYCYRLSGYAQRKRPAVAPLSGKEAKGPLQDGPAADANGRASTVANSAERTSGSSV
NGLEEPSVAKRLRGTPERIELENYRRSVKRAEELEEVPEETQAEHNLSSVLDKGTEEDVA
SSHSFPRAMPSPEPTLN
Download sequence
Identical sequences ENSCPOP00000012050 10141.ENSCPOP00000012050 ENSCPOP00000012050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]