SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012099 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012099
Domain Number 1 Region: 147-463
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.11e-127
Family Transglutaminase core 0.00000000831
Further Details:      
 
Domain Number 2 Region: 4-145
Classification Level Classification E-value
Superfamily E set domains 6.65e-40
Family Transglutaminase N-terminal domain 0.0002
Further Details:      
 
Domain Number 3 Region: 470-582
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 7.59e-28
Family Transglutaminase, two C-terminal domains 0.00028
Further Details:      
 
Domain Number 4 Region: 584-682
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.2e-27
Family Transglutaminase, two C-terminal domains 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012099   Gene: ENSCPOG00000013438   Transcript: ENSCPOT00000013570
Sequence length 684
Comment pep:known_by_projection scaffold:cavPor3:scaffold_10:28646966:28671583:-1 gene:ENSCPOG00000013438 transcript:ENSCPOT00000013570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLTGLEVALSDLRSSWNNVYHHTEDISVDHLLVRRGQAFNITLYFRNRGFLPVVDNIIFV
VETGPLPDLAKGTRAVFSLGKHGGPRSWIALPEMQGDTSLEVSLCAPPMAAVGRYVLKVH
INSFQGTVSAYQLGEFILLFNPWCPGDAVYLDSEPQRQEYVVNDYGFIYQGNKNWIRPCP
WNYGQFEDNIIDICLELLDKSLNFQIDPATDCALRGNPVYISRVVCAMINSNDDNGVLNG
NWSENYLDGVNPAEWTGSVAILKKWHATGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVTT
NFDSGHDTDGNLIIDEYYDSTGRILENKKRDTVWNYHVWNECWMARQDLPPGYGGWQVLD
ATPQETSNGLYCCGPASVRAIKEGEVDLNYDTPFVFAMVNADCMSWLVYGGKEQKLHQDT
TSVGHFISTKSIQSDERDDITENYKYGEGSPEERLVFQKALQKLRARRSQGVSLKFKLLD
PPNMGQDINFVLLALNMSSQFKDLKVNLSAQSLLHDGNPLPPFWQDTAFISLSPDEEKTY
TCKIPYSQYSQYLSTDKLIRISALGEEKSSPEKILVNKIITLTYPGITINILGAAIMYQP
LSIQVIFSNPLLEPVEDCVLTLEGSGLFKKQQRILIGVLKPHHKATITVKTIPFKSGPRQ
IQANLRSNKFKDIKGYRNLYVDFA
Download sequence
Identical sequences ENSCPOP00000012099 10141.ENSCPOP00000012099 ENSCPOP00000012099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]