SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012110 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012110
Domain Number 1 Region: 1-355
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.38e-62
Family GDI-like N domain 0.000000000376
Further Details:      
 
Domain Number 2 Region: 389-434
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000012
Family GDI-like N domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012110   Gene: ENSCPOG00000013449   Transcript: ENSCPOT00000013581
Sequence length 445
Comment pep:known_by_projection scaffold:cavPor3:scaffold_16:17378597:17413374:1 gene:ENSCPOG00000013449 transcript:ENSCPOT00000013581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDQNPYYGGESASITPLEDLYKRFKLPG
VPPASMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYMDFKVIEGSFVYKGGKIYKVS
STEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDLYKKFDLGQD
VIDFTGHSLALYRTDDYLDQPCLETIDRIKLYSESLARYGKSPYLYPLYGLGELPQGFAR
LSAIYGGTYMLNKPIEEIIVQNGKVVGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRV
ICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISSAHNVAAQGKYIAIVSTTVETK
EPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTDSQIFISRAYDATTHFETTCDDIKDI
YKRMTGSEFDFEEMKRKKNDIYGED
Download sequence
Identical sequences ENSCPOP00000012110 XP_005008586.1.53824 10141.ENSCPOP00000012110 ENSCPOP00000012110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]