SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012331 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012331
Domain Number 1 Region: 228-504
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.04e-109
Family N-acetyl transferase, NAT 0.0000000309
Further Details:      
 
Domain Number 2 Region: 3-118
Classification Level Classification E-value
Superfamily Chromo domain-like 8.24e-22
Family Chromo barrel domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012331   Gene: ENSCPOG00000013693   Transcript: ENSCPOT00000013832
Sequence length 513
Comment pep:known_by_projection scaffold:cavPor3:scaffold_42:6406534:6412864:1 gene:ENSCPOG00000013693 transcript:ENSCPOT00000013832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEVGEVIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTH
ERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPK
EREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGSARRAV
AAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRH
RLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTIS
FFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKE
STEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQ
TILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDI
VDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW
Download sequence
Identical sequences H0VPB3
ENSCPOP00000012331 XP_003468288.1.53824 10141.ENSCPOP00000012331 ENSCPOP00000012331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]