SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012332 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012332
Domain Number 1 Region: 60-81,168-245,273-378
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000229
Family FAD/NAD-linked reductases, N-terminal and central domains 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012332   Gene: ENSCPOG00000013694   Transcript: ENSCPOT00000013833
Sequence length 549
Comment pep:known_by_projection scaffold:cavPor3:scaffold_0:25070758:25091567:-1 gene:ENSCPOG00000013694 transcript:ENSCPOT00000013833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVWCCAAPARASQRNYSDPETEGEIFNSLVQYFDDNLVRKVKAMPLVEETSLLEDSSVT
LPVVIIGNGPSGICLSYMLSGYRPYLSSEAIHPNTILHSKLEEARHLSIVDQDLEYLSEG
LEGRSSNPVAVLFDTLLHPDADFGYDYPSILHWKLEQHHYIPHLVLGKGPPGGAWHNMEG
SMLTISFGNWMELPGLKFKDWVSSKRRNLKGDRVMPEEIARYYKHYVKVMGLQKNFRENT
YITSVSRLYREQDESDDQDRDISTEHLQIEKSKFVKRNWEIRGYQQIADGSPVPFCLFAE
NVALATGTLDSPAHLEVEGEDFPFVFHSVPEFGAAIGKGKFRGKVDPVLIVGSGLTAADA
VLCAYNSNIPVIHVFRRRVTDSLIFKQLPKKLYPEYHKVYHMMCTQSYSTDSNLLSDYTS
FPEHHVLSFMSDMKCVLQSVSGLKKIFKLSAAVVLIGSHPNLSFLKEQGCYLGHNSSQPI
TCKSNPVEIDAYTYECVKEANLFALGPLVGDNFVRFLKGGALGVTRCLTIRQKKKQHLFV
ERGGGDGIA
Download sequence
Identical sequences 10141.ENSCPOP00000012332 ENSCPOP00000012332 ENSCPOP00000012332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]