SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012335 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012335
Domain Number 1 Region: 380-512
Classification Level Classification E-value
Superfamily TIMP-like 1.26e-34
Family Netrin-like domain (NTR/C345C module) 0.016
Further Details:      
 
Domain Number 2 Region: 197-255
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000113
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 3 Region: 253-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000642
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 4 Region: 316-355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000809
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 5 Region: 8-87
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000142
Family Galactose-binding domain 0.046
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000012335
Domain Number - Region: 67-138
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0549
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012335   Gene: ENSCPOG00000013697   Transcript: ENSCPOT00000013836
Sequence length 514
Comment pep:known_by_projection scaffold:cavPor3:scaffold_61:7953186:8130587:1 gene:ENSCPOG00000013697 transcript:ENSCPOT00000013836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRSCHLCASDPKKAHPPAFLTDLNNPHNLTCWQSENFLQFPHNVTLTLSLGKKFEVTYVS
LQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQNEQEAVCTDSHT
DMRPLSGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAFSRLHTFGDENEDDSELA
RDSYFYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQ
RATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFY
RDMGKPITHRKACKACDCHPVGAAGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPI
APCIKIPVAPPTTAASSVEEPEDCDSYCKASKGKLKINMKKYCKKDYAVQIHILKADKAG
DWWKFTVNIISVYKQGTSRIRRGDQSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSPDQS
GIVADKSSLVIQWRDTWARRRKFQQREKKGKCKK
Download sequence
Identical sequences ENSCPOP00000012335 ENSCPOP00000012335 10141.ENSCPOP00000012335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]