SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012497 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012497
Domain Number 1 Region: 1-224
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.15e-56
Family FAD/NAD-linked reductases, N-terminal and central domains 0.003
Further Details:      
 
Domain Number 2 Region: 313-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.15e-16
Family FAD/NAD-linked reductases, N-terminal and central domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012497   Gene: ENSCPOG00000013868   Transcript: ENSCPOT00000014008
Sequence length 533
Comment pep:known scaffold:cavPor3:scaffold_2:44994311:45015477:-1 gene:ENSCPOG00000013868 transcript:ENSCPOT00000014008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKKRIAVIGGGVSGLSSIKCCLEEGLEPVCFERSADIGGLWRFQENPEEGRASIYKSVI
INTSKEMMCFSDYPIPDHYPNFMHNSHVLEYFRMYAKEFGLLKYIQFKTTVCNVKKRPDF
STSGQWEVVTEHEGKTKVDVFDAVMVCTGHHTNAHLPLESFPGIEKFKGQYFHSRDYKNP
EAFTGKRVVIIGIGNSGGDLAVEISHTAKQVFLSTRRGSWILNRVGKHGYPTDVLLSSRF
TYFLSKILGQSLSNAYVEKQMNERFDHEMFGLKPKHRAMSQHPTVNDDLPNRIIAGMVKV
KGNVKEFTETAAIFEDGSREDDIDAVIFATGYSFDFPFLEDSVKVVKNKVSLYKKVFPPN
LERPTLAIIGLIQPLGAIMPISELQGRWAVQVFKGLKTLPSQSEMMAEITKAQEEIAKRY
VDSQRHTIQGDYIQTMEEIAEFVGVKPNLLSLAFTDPKLALKLFFGPCTPIHYRLQGPGK
WHGARKAILTTYDRIRKPLNTRETEKSNSMVSAVTTGCFMLAVVFFAIIMAYA
Download sequence
Identical sequences P49109
NP_001166418.1.53824 XP_012998115.1.53824 XP_012998116.1.53824 XP_012998117.1.53824 ENSCPOP00000012497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]