SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012538 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012538
Domain Number 1 Region: 1-228
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.37e-53
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0044
Further Details:      
 
Domain Number 2 Region: 312-484
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000233
Family FAD/NAD-linked reductases, N-terminal and central domains 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012538   Gene: ENSCPOG00000013912   Transcript: ENSCPOT00000014053
Sequence length 532
Comment pep:known_by_projection scaffold:cavPor3:scaffold_12:12332291:12347141:-1 gene:ENSCPOG00000013912 transcript:ENSCPOT00000014053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKKVAIIGAGVSGLASIRSCLEEGLEPICFERSNDIGGLWKFSDHAEEGRASIYKSVFT
NSSKEMMCFPDVPFPDDFPNFMCHRKLQEYIVAFAKQKSLLKYIQFETLVTSVTKRPDFS
ITGQWDITTEKHGKKQSAVFDAVMVCSGHHVYPNIPKESFPGLKDFKGKCFHSRDYKEPG
IWKGKRVLVIGLGNSGCDIAAELSHTAEQVMISSRSGSWVMSRVWDDGYPWDMLFVTRFQ
SFLKNKLPTAISDWWYVKQMNARFKHENYGLMPLNGTLRKEPVFNDELPARILCGTVSIK
PNVKKFTETAAIFEDGTKFEGIDCVIFATGYTYAYPFLDESIIKSRNNETTLYKGIFPPH
LEKSTFAVIGLVQSLGAAIPTTDLQARWATQVIKGTCTLPSVKVMMDDIDGKVGKNKKWF
GQSETLQTDYVVYMDEIASFIGAKPNILWLFLTDPVLAVEVFFGPCSPYQFRLEGPGKWS
GARNAILTQWDRTLKPTSTRIVGDLQKPYVFFHLFKLFTISILFIALFLMLI
Download sequence
Identical sequences H0VPU5
ENSCPOP00000012538 ENSCPOP00000012538 10141.ENSCPOP00000012538 XP_003474791.1.53824 XP_013013529.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]