SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012570 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012570
Domain Number 1 Region: 318-681
Classification Level Classification E-value
Superfamily SIS domain 3.34e-105
Family double-SIS domain 0.000000524
Further Details:      
 
Domain Number 2 Region: 2-208,249-293
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.39e-53
Family Class II glutamine amidotransferases 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012570   Gene: ENSCPOG00000013949   Transcript: ENSCPOT00000014090
Sequence length 681
Comment pep:known_by_projection scaffold:cavPor3:scaffold_255:94293:118340:-1 gene:ENSCPOG00000013949 transcript:ENSCPOT00000014090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGIFAYMNYRVPRTRKEIFETLIKGLQRLEYRGYDSAGVAIDGNNHEVKERHIQLVKKKG
KVKALDEELYKQDSMDLKVEFETHFGIAHTRWATHGVPSAVNSHPQRSDKGNEFVVIHNG
IITNYKDLRKFLESKGYEFESETDTEAIAKLIKYVFDNREIEDITFSTLVERVIQQLEGA
FALVFKSIHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPILYRTCNIENVKNICKTRMKR
LDSSTCLHAVGNKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSASD
DPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDHL
KEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFI
SQSGETADTLLALRYCKDRRALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKAYTS
QFISLVMFGLMMSEDRISLQDRRREIIRGLRALPELIKEVLALEEKIHDLALELYTQRSL
LVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKQMPVIMVIMKDPCFA
KCQNALQQVTARQGRPIILCCKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFHL
AVLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences ENSCPOP00000012570 ENSCPOP00000012570 10141.ENSCPOP00000012570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]