SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012602 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012602
Domain Number 1 Region: 3-227
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.31e-49
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0044
Further Details:      
 
Domain Number 2 Region: 311-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000168
Family FAD/NAD-linked reductases, N-terminal and central domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012602   Gene: ENSCPOG00000013986   Transcript: ENSCPOT00000014127
Sequence length 535
Comment pep:known_by_projection scaffold:cavPor3:scaffold_12:12232679:12257128:-1 gene:ENSCPOG00000013986 transcript:ENSCPOT00000014127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKVAVIGAGVSGLISLKCCVDEGLEPTCFERTEDIGGLWRFKENVEDGRASIYKSVIT
NTSKEMSCFSDFPMPEDFPNFLHPSGLISIERMYGKKSNLFKYLQYRTTVLTVKKHPDFS
SSGQWEVVTQSDGKEQSAVFDAVMVCSGHHILPHIPLKSFPGIERFKGQYFHSRQYKHPA
GFEGKRILVIGIGNSASDIASELSKNAAQVFISTRNGSWVMSRISEDGYPWDMVFHTRFK
SMLRNILPRTVSKWMMEQQLNRWFNHANYSLEPKNKYLMKEPILNDDLPSRILYGAVKVK
SRVTQLTETSALFEDGTVEEDIDVIVFATGYTFSFPFLEESLVKIEHNMVSLYKYMFPPQ
LEKPTLTCMGLIQPLGSIFPTVELQARWATRVFKGLCHLPSEKTMMEDIIKRNEKRIDLF
GESQSQIVQTNYVDYLDELALEIGAKPDLISFLLKDPELAVKLCFGPCNSYQYRLVGPGQ
WEGARRAILTQKQRILKPLKTRSVKAAPNLSASFLMKILALLAVFVVLICQHNTS
Download sequence
Identical sequences ENSCPOP00000012602 ENSCPOP00000012602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]