SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012607 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012607
Domain Number 1 Region: 3-219
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.21e-53
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0076
Further Details:      
 
Domain Number 2 Region: 316-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000209
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012607   Gene: ENSCPOG00000013990   Transcript: ENSCPOT00000014132
Sequence length 532
Comment pep:known_by_projection scaffold:cavPor3:scaffold_12:12185352:12207347:-1 gene:ENSCPOG00000013990 transcript:ENSCPOT00000014132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRVAIVGAGVCGLASIKCCLEEGLQPTCFERSDDVGGLWRFTEYVEEGRASLYKSVVS
NSSKEMSCYSDFPFPEDYPNFIPNDLFIEYLKLYAKQFNLLKCIQFKTKVCSVTKCPDFD
VTGQWEVVTLHEGKQNSAIFDAVMVCTGFLTDPYLPLSSFPGINTFKGQYFHSREYKHPD
VFKDKRVLVVGMGNSGTDIAVEASHLAKKVFLSTTGGAWVISRVFDSGYPWDMVFMTRFQ
NAFRNFLPTPIVTRLIAKKMNSWFNHANYGLIPENKTQLREPILNDELPGRIITGKVLIK
PSIKGVKENSVIFNNTPKEEPIDVIVFATGYTFSFPFLDESVVKVEDGQASLYKYIFPAH
LQKPTLAVIGLIKPLGSMLPTGETQARWVVQVLKGRSVLPPPSVMMKEVNERKEEEKGKF
GLDYCKALQSDYIPYIDELLASINAKPNLLSMLLTDPLLVLTIVFGPCSPYQFRLAGTGK
WEGARKAIMTQWDRTIKATKTRTVQESPFPFESLLKLFSILVLLVAVFLILL
Download sequence
Identical sequences 10141.ENSCPOP00000012607 ENSCPOP00000012607 ENSCPOP00000012607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]