SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012721 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012721
Domain Number 1 Region: 922-1187
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-51
Family YWTD domain 0.00000233
Further Details:      
 
Domain Number 2 Region: 1542-1787
Classification Level Classification E-value
Superfamily YWTD domain 8.24e-47
Family YWTD domain 0.0000197
Further Details:      
 
Domain Number 3 Region: 192-455
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-46
Family YWTD domain 0.00000634
Further Details:      
 
Domain Number 4 Region: 1237-1494
Classification Level Classification E-value
Superfamily YWTD domain 7.72e-43
Family YWTD domain 0.0000216
Further Details:      
 
Domain Number 5 Region: 2677-2933
Classification Level Classification E-value
Superfamily YWTD domain 1.05e-40
Family YWTD domain 0.0000209
Further Details:      
 
Domain Number 6 Region: 1850-2116
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-31
Family YWTD domain 0.00012
Further Details:      
 
Domain Number 7 Region: 2583-2669,2925-2988
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.51e-23
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 8 Region: 1-130
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-21
Family YWTD domain 0.00027
Further Details:      
 
Domain Number 9 Region: 825-914,1488-1537
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-17
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 10 Region: 539-584
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 11 Region: 583-622
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 12 Region: 2552-2593
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 13 Region: 503-542
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.00052
Further Details:      
 
Domain Number 14 Region: 3425-3464
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 15 Region: 627-665
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 16 Region: 3337-3381
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 17 Region: 3216-3251
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 18 Region: 2421-2457
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000537
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 19 Region: 3016-3056
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 20 Region: 3295-3331
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 21 Region: 2207-2248
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 22 Region: 3256-3293
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 23 Region: 3139-3175
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000838
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 24 Region: 666-702
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000903
Family LDL receptor-like module 0.00026
Further Details:      
 
Domain Number 25 Region: 2464-2499
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000969
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 26 Region: 2341-2378
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 27 Region: 714-750
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 28 Region: 2979-3014
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000484
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 29 Region: 3099-3135
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000707
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 30 Region: 3173-3213
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000102
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 31 Region: 3058-3095
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000118
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 32 Region: 2251-2288
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 33 Region: 2381-2418
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 34 Region: 2500-2541
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 35 Region: 3468-3549
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000121
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 36 Region: 2172-2209
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 37 Region: 761-793
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 38 Region: 2302-2337
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000314
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 39 Region: 796-832
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000511
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 40 Region: 1806-1855
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000316
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 41 Region: 3383-3415
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000144
Family LDL receptor-like module 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000012721
Domain Number - Region: 460-516
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000147
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 145-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00183
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 2126-2187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0361
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012721   Gene: ENSCPOG00000014122   Transcript: ENSCPOT00000014264
Sequence length 3666
Comment pep:novel scaffold:cavPor3:scaffold_3:46099144:46721425:1 gene:ENSCPOG00000014122 transcript:ENSCPOT00000014264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLFFTDYGNVAKVERCDMDGTNRTRIVDSKAEQPSALAVDLINKLVYWVDLYLDYVGVVD
YQGRHRHTVIQGRQIRHLYGITVFEDYLYATNSDNFNIIRINRFNGTDIHSLIKMERPQG
IRIYQKRTQPTVRSHACEVDPYGMPGGCSHICLLSGSYKMRTCRCRTGFNLGSDGRSCKR
PKNELFLFYGKGRPGIVRGMDLNTKIADEYMIPIENLVNPRAVDFHAETSYIYFADTTSF
LIGRQKIDGTERETISERDLDNVEGIAVDWIGNNLYWTNDGHRKTINVARLEKASQSRKT
LLEGEMSHPRGIVVDPVNGWMYWTDWEEDEIDASVGRIEKAWMDGFNRQIFVTSKMLWPN
GLTLDFHASTLYWCDAYYDHIEKVFLNGTHRKVVYSGKELNHPFGLSHHGNYLFWTDYMN
GSIFQLDLIMREVTLLRHERPPLFGLQIYDPRKQQGDNMCRVNNGGCSTLCLAIPAGRVC
ACADNQLLDENGTTCTFNPGEILPRICKAGEFRCKNRHCIQARWKCDGDDDCLDGSDEDP
INCFNHSCPDDQFKCQNNRCIPKKWLCDGANDCGSNEDESNETCSARTCQSDQFACGNGR
CIPRAWLCDREDDCGDQTDEMATCEFPTCEPLTQFICKNGRCISSKWHCDADDDCGDGSD
ELGCVHACFDNQFRCSSGRCIPGHWTCDGDNDCGDFSDETQANCTKEEIQSPAGCNGNEF
QCYPDGNCIPDLWHCDGEKDCEDGSDEKGCNGTIRLCDYKTKFSCRSTGRCINKAWVCDG
DIDCEDQSDEEDCDSFLCGPPKYPCANDTSVCLQPEKLCNGKRDCPDGSDEGDLCDECSL
NNGGCSNQCSVVPGRGIVCSCPKGLQLNKDNKTCEIVDYCSSHLKCSQVCEQHKHTVKCS
CYEGWKLDADGESCTSVDPFEAFIIFSIRHEIRRIDLHKRDYSLLVPGLRNTIALDFHFN
QSLLYWTDVVEDRIYRGKLSESGGVSAIEIVVEHGLATPEGLTVDWIAGNIYWIDSNLDQ
IEVAKLDGSLRTTLIAGAMEHPRAIALDPRFGILFWTDWDANFPRIESASMSGAGRKTIY
KDMKTGAWPNGLTVDHFEKRIVWTDARSDAIYSALYDGTNMIEIIRGHEYLSHPFAVSLY
GSEVYWTDWRTNTLSKANKWNGQNVSVIQKTSAQPFDLQIYHPSRQPQACNKCSSQKGDT
KIYLLCIHNYSLSTHISCLHASKTSRDSTTLFHKCKYILYARRSEIRGVDIDNPYFNFIT
AFTVPDIDDVTVIDFDASEERLYWTDIKTQTIKRAFINGTGLETVISRDIQSIRGLAVDW
VSRNLYWISSEFDETQINVARLDGSLKTSIIHGIDKPQCLAAHPVRGKLYWTDGNTINMA
NMDGSNSKILFQNQKEPVGLSIDYVENKLYWISSGNGTINRCNLDGGNLEVIESMKEELT
KATALTIMDKKLWWADQNLAQLGTCSKRDGRNPTILRNKTSGVVHMKVYDKEAQQGSNSC
HLNNGGCSQLCLPTSENTRTCMCTVGYYLQKNRMSCQGIESFLMYSVHEGIRGIPLEPSD
KMDALMPISGTSFAVGIDFHAENDTIYWTDMGFNKISRAKRDQTWKEDIITNGLGRVEGI
AIDWIAGNIYWTDHGFNLIEVARLNGSFRYVVMSQGLDQPRSIAVHPEKGFLFWTEWGQM
PRIGKSRLDGSEKLVLVSTGIAWPNGISIDYEENKLYWCDARTDKIERIDLETGSNREMV
LSGSNVDMFSVAVFGAYIYWSDRAHANGSIRRGHKNDATEMVTMRTGLGVNLKEIKIFNR
VREKGTNICAKDNGGCKQLCLYRGNSRRTCACAHGYLAEDGVTCLRHEGYLLYSGRTILK
SIHLSDETNLNSPIRPYGNPHYFKNVIALAFDYNQRRKGTNRIFYSDAHFGNIQLIKDNW
EDRQVIVENVGSVEGLAYHRAWDTLYWTSSTTSSITRHTVDQTRPGAFDREAVITMSEDD
HPHVLALDECQNLMFWTNWNEQHPSIMRSTLTGKNAQVVVSTDILTPNGLTIDHRAEKLY
FSDGSLGKIERCEYDGSQRHVIVKSGPGTFLSLAVYDNYIFWSDWGRRAILRSNKYTGGD
TKILRSDIPHQPIGIIAVANDTNTCELSPCAVLNGGCHDLCLLTPDGRVNCSCRGDRILL
DDNRCVTKNSSCNIYSEFECGNGECIDYQLTCDGTPHCKDKSDEKLLYCENRSCRRGFKP
CHNRRCIPHAKLCDGENDCGDNSDELDCKVSTCATVEFHCADGTCIPRSARCNQNIDCAD
ASDEKNCNNTDCTHFYKLGVKTEGFIKCNSTSLCVLPTWICDGSNDCGDYSDELKCPVQN
KHKCEENYFGCPSGRCILNTWICDGQKDCEDGLDELHCDSSCSWSQFACSAQKCISKHWV
CDGEDDCGDGLDESDSICGDITCAADMFSCQGSHACVPRHWLCDGERDCPDGSDELSTAG
CAPNNTCDENAFMCHNKVCIPKQFVCDHDDDCGDGSDELLKCGYRQCSAEEFRCADGRCL
LNTQWQCDGDFDCPDHSDEAPLNPKCKHAEQSCNSSFFMCKNGRCIPSGNLCDSKDDCGD
GSDERNCHINECLSKKTSGCSQDCQDLPVSYKCKCWPGFQMKDDGKTCVDIDECSSGFPC
SQHCINTYGTYKCLCTDGYKIQPDNPNGCKSLSDEEPFLILADHHEIRKISTDGSNYTLL
KQGLNNVIAIDFDYREEFIYWIDSSRPNGSRINRMYLNGSDIKVVHNTAVPNALAVDWIG
KNLYWSDMEKRIIEVSKVNGLYPTILVSKRLKFPRDLSLDPRAGYLYWIDCCEYPHIGRV
GMDGTNQSVVIETKISRPMALTIDYVNHRLYWADENHIEFSNMDGSHRHKVPNQDIPGVI
ALTLFEDYIYWTDGKTKSLNRAHKTSGADRLSLVSSWHVITDVQVYHSYRQPDGVVPKHL
CMINNGGCSHLCLLAPGKTHTCACPTNFYLAADNRTCLSNCTASQFRCKTDKCIPFWWKC
DTVDDCGDGSDEPDDCPEFKCQPGRFQCGTGLCALPAFICDGENDCGDNSDELNCDTHVC
LSGQFKCTKNQKCIPVNLRCNGQDDCGDEEDERDCPENSCSPDYFQCKTTKHCISKLWVC
DEDPDCADASDEANCDKKTCGPHEFQCKNSNCIPDHWRCDSQNDCSDNSDEENCKPQTCT
LKDFLCASGDCVSSRFWCDGDFDCADGSDERHCEVSCSKDQFQCSNGQCISAKWKCDGHE
DCKYGEDEKNCEPASPSCSSSEYICTSGGCISASLKCNGEYDCADGSDEMGCVTECKENQ
FRCKNKAHCIPVRWLCDGIHDCMDGSDEEICDRGGNICRADEFLCNNSLCKLYFWVCDGQ
DDCGDNSDEAPDMCVKFLCPPTRPHRCRNNRICLQSEKTCNGVDDCGDNSDEEHCDDFIG
KVTYKAKPCKKDEFTCSNKKCIPMDLQCDRLDDCGDGSDEQSCRTTPTEYTCEDNVNPCG
DDAYCNQIKTSVFCRCKPGFQRNMKNRQCEDLNECLVFGMCSQQCINIEGSYKCVCDQNF
QVQNNTCIAKGSEDQVLYIANDTDILGFIYPFNYSGNHQQISHIEHNSRITGMDVYFQRD
MIIWSTQFNPGGIFYKMIHGREKREANSGLIICITFMHKRMFEVTWEKNDNYFFKFSNMQ
WFYFYS
Download sequence
Identical sequences 10141.ENSCPOP00000012721 ENSCPOP00000012721 ENSCPOP00000012721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]