SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012796 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012796
Domain Number 1 Region: 136-406
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.32e-37
Family Eukaryotic proteases 0.00035
Further Details:      
 
Domain Number 2 Region: 42-103
Classification Level Classification E-value
Superfamily GLA-domain 6.28e-22
Family GLA-domain 0.00055
Further Details:      
 
Domain Number 3 Region: 92-128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000198
Family EGF-type module 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012796   Gene: ENSCPOG00000014204   Transcript: ENSCPOT00000014346
Sequence length 406
Comment pep:known_by_projection scaffold:cavPor3:scaffold_5:14480885:14487672:-1 gene:ENSCPOG00000014204 transcript:ENSCPOT00000014346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSHILLLQGLAVLLLHQAELLVFVPASSANQVLLRWKRAGSYILEELFEGNLEKECYEE
ICVHEEAREVFEDDDATGAFWREYRGGSPCISQPCLNNGSCQDTIRSFTCTCSPGFEGRT
CALAKNRCHAERPDGCQHFCHPGEASFTCSCAQGHKLGKDQRSCVPHEQCACGILASRLN
EKAESSGLRPPWFPWQVTLTDPQGKDFCGGVLVQDRFVLTTAQCSLSHRNITVKSSPASP
GEAPWTARVRHAHVHMHYDAESGQNDVSLLQLERPVQCPGSGLPVCTPEWDFAKQVLIPR
TVGVLSGWMINGTDLDDTLATLPVTQVDREECSQALNVTITTRMSCERSDAAAGPWVAGS
MVAREHKGTWFLTGILGSSPRPQEQTATFLVTKVSRYALWFKQTMK
Download sequence
Identical sequences H0VQH4
ENSCPOP00000012796 10141.ENSCPOP00000012796 ENSCPOP00000012796 XP_012996780.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]