SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012842 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012842
Domain Number 1 Region: 2729-2892
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.08e-37
Family Laminin G-like module 0.0000000774
Further Details:      
 
Domain Number 2 Region: 2899-3081
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.86e-35
Family Laminin G-like module 0.00000004
Further Details:      
 
Domain Number 3 Region: 2300-2487
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.08e-30
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 2487-2675
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.13e-25
Family Laminin G-like module 0.015
Further Details:      
 
Domain Number 5 Region: 2115-2291
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-24
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 828-882
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000414
Family Laminin-type module 0.0026
Further Details:      
 
Domain Number 7 Region: 778-830
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 8 Region: 1383-1434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000142
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 9 Region: 1440-1492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000234
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 10 Region: 720-772
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family Laminin-type module 0.0058
Further Details:      
 
Domain Number 11 Region: 881-927
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000642
Family Laminin-type module 0.0034
Further Details:      
 
Domain Number 12 Region: 1023-1071
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000215
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 13 Region: 250-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000502
Family Laminin-type module 0.041
Further Details:      
 
Domain Number 14 Region: 930-979
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000153
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 15 Region: 1490-1531
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000391
Family Laminin-type module 0.0068
Further Details:      
 
Domain Number 16 Region: 377-434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000544
Family EGF-type module 0.089
Further Details:      
 
Domain Number 17 Region: 977-1020
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000265
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 18 Region: 52-132
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000567
Family APC10-like 0.053
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000012842
Domain Number - Region: 307-379
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000195
Family Laminin-type module 0.018
Further Details:      
 
Domain Number - Region: 1677-1698,1726-1918
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000249
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.01
Further Details:      
 
Domain Number - Region: 1082-1126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000335
Family Laminin-type module 0.019
Further Details:      
 
Domain Number - Region: 1342-1369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00053
Family Laminin-type module 0.049
Further Details:      
 
Domain Number - Region: 447-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00117
Family Laminin-type module 0.015
Further Details:      
 
Domain Number - Region: 684-722
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0363
Family EGF-type module 0.05
Further Details:      
 
Domain Number - Region: 1993-2088
Classification Level Classification E-value
Superfamily Tropomyosin 0.0785
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012842   Gene: ENSCPOG00000014253   Transcript: ENSCPOT00000014395
Sequence length 3083
Comment pep:known_by_projection scaffold:cavPor3:scaffold_41:3017893:3443727:-1 gene:ENSCPOG00000014253 transcript:ENSCPOT00000014395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLFPAVLNLASNALITTNATCGERGPEMYCKLVEHVPGQPVRNPQCRICNQNSSNPYQRH
PITNAIDGKNTWWQSPSIKNGIEYHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERS
LDNVEYKPWQYHAVTDTECLNRYGIYPRTGPPFYAKDDEVICTSFYSKIHPLENGEIHIS
LINGRPSADDPSPELLEFTSARYIRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYS
VKDISVGGMCICYGHARACPLDPATNKSRCECEHNTCGDSCDQCCPGFHQKLWRAGTFLT
KTECEPCNCHGKAEGCYYDENVARRNLSLNIHGKYIGGGVCINCSQNTAGINCETCTDGY
FRPKGVSPNYPSPCQPCYCDPVGSLSKVCVKDEKHARRGLAPGSCHCKAGFGGVSCDRCA
RGYTGYPDCQPCNCSGSGSTNVDPCFGPCTCKENVEGGDCSRCKSGFFNLQEDNPKGCDE
CFCSGVSNRCQSAYWTYGKTQDMNGWYLTDISGRIRLAPHLDNSGSPEQISISNAEARQA
LPDNYYWSAPAAYLGNKLPSVGGQLTFTISYDLEEEEGDTENVLQLMIILEGNGLRINTA
QEEVYLQPSEEYINILSLREDSFTVHGTNFPVSRKDFMTLLTDLKRVLIQITYSFGMDAI
FRLSDVSLESAVPSPTDGSLATAVEVCQCPPGYSGSSCESCWPRHRRVNGTIFGGICEPC
QCFGHAESCDDITGECLHCKDHTGGPYCNTCLPGFYGDPMQGTAEDCQPCACPLSVLSNN
FSPTCHLDPSLGLICDECSVGYTGPRCERCEEGYFGHPSVPGGSCQPCQCNDNLDFSVPG
SCNSLSGSCLICKPGTTGRHCELCADGYFGDAVDAKNCQPCRCNANGSSSEICHSQTGQC
ECRPNVQGRQCDQCKPQTFGLQSGRGCVPCNCNSFGSKSFDCDESGQCWCQPGVTGKKCD
HCAHGYFNFQEGGCTACDCSHLGNNCDPQTGQCICPPNTVGEKCSTCAPNSWGHSIVTGC
KPCNCSIVGSLNFQCNINTGQCDCHPKFSGAKCTTCKQGHWNFPHCLLCDCFLPGTEAAT
CDSETQICSCSDQTGQCTCKANVEGIHCDRCQSGKFGLEAKNPHGCSSCYCFSVTSQCSA
AEGLIHKQVTLEAEQIILPLVDEALQHTTTKGIASQPPEIVADMHLVRQDLRLEPFYWKL
PEQFEGKKLMAYGGKLKYTIYFEAREETGLSTYKPQVIIRGGTPSHARLIVRHVAAPLIG
QLTRHEIEMTEKEWKYYGDDPRISRTVSREDFMDVLYDIHYILIKATYGNIMRQSRISEI
SMEVAEPGPATAATPPALLIEKCDCPPGYSGLSCEMCSPGFYRLRPEPGGHSPRLTLGTC
VPCQCHGHSNLCDPETSVCQDCQHHTAGDFCERCAVGYYGTVKGLPNDCQQCACPLISPS
NNFSPSCVAEGQDDHRCTACPRGYEGQYCERCAPGYTGSPSSPGGSCQECECDPYGSLPV
PCDRVTGLCMCRPGATGHKCDSCQPGHAREGAECVFCGDECTGLLLGDLARLQQMAMGIN
LTGPLPAPYKVLYGLENTTQELKHLLSPQRAPERLLQLAEDNLSTLVTEMDELLTRATKV
TADGEQTGQDADRTNRRAKSLGELIKELARDAEDVNEKAVKLNETLGIQDKDFDRNLQEL
QKEIDQMMNELRRKNLDTQKEVAEDELVASEGLLMKVNKLFGEPRRKNEKMEKELQDKLA
DYNNRLDDAWDLLRNATDKIREANRLSAANQNNMTALEKKKEAVESGRRQIENTLKEGND
ILGEANRLAYEISSIIEYVEDLRSKLPPMSKELTDKIAELSQEIKDRKLAENVSQAESHA
AQLNESSAVLDGILEEAKNISFNATAAFNAYSNIKDYIDEAEKVATEARGLAHEATKLAT
SPRGLLREDAKGSLQKSFRILNEAKKLANDVKQNDEQLNGLTTRLEDAEARNDALLRALN
DTLGKLSTIPNDTAAKLQAVKDKARQANDTAKAVLAQIKDLHQNLDGLKKNYNKLAESVA
ETNAVVKDPSKNKIITDADATVKNLEQEANRLLDQLKPIKELEDNLKKNISEIKELINQA
RKQANSIKVSVSSGGDCIRTYKPEIKKGSYNNIIINVKTAVADNLLFYLGSAKFTDFLAI
EMRKGKVSFLWDVGSGVGRIEYPDLTIDDTYWYRIEASRTGRNGSISVRALDGPKASIMP
GTYHSVSPPGYTILDVDADAMLFVGGLTGKLKKADAVRVTTFTGCMGETYFDNKPIGLWN
FREIEGDCKGCTVSPQVEDSEGTIQFDGEGYALVSRPIRWYPNISTVMFKFRTFSSSALL
MYLATRDLKDFMSVELADGHIKVSYDLGSGMASVVSNQNHNDGKWKSFTLSRIQKQANIS
IVDIDTNEEENIATSSSGNNFGLDLKADDKIYFGGLPTLRNLSMKARPEVNVRKYSGCLK
DIEISRTPYNILSSPDYVGVTKGCSLENVYTVSFPKPGFVELAPVPFDVGTEINLSFSTQ
SESGLILLGSGGSPVPPRRKRRQTGQAYYAILLNKGRLEVHLSTGIRTMRKIVIKPEQSL
FHDGREHSVHVERARGIFTVQVDEDRRHMQNLTVEHPIEVKKLFVGGAPPEFQPSSLQNI
SPFEGCVWNLVINSVPMDFARPVSFKNADIGRCSHQKPEEEAIPAEIIVQPEPMATPALP
TPTPTPAQGPCAAESKPALLMGSKQFGLSRNSHIAMAFDDTKVKNRLTIELEVRTEAESG
LLFYMARINHADFATVQLRDGLPYFRYDLGSGDTSTMIPTKINDGQWHKIKIMRSKQEGI
LYVDDASNRTTSPKKADILDVVGMLYVGGLPVNYTTRRIGPVTYSIDGCIRNLHMEEAPV
DMERPTSSFRVGTCFVSAQRGTYFDGTGFAKAAVGGFKVGLDLLIELEFRTTRTTGVLLG
ISSQKMDGLGIELVDEKLMFHVDNGAGRFTAVYDAGVPGYLCDGQWHKVTANKIKHRLEL
TVDGNQVEAQSPNPASTSADTNDPVFVGGFPDDLKQFGLTTNVRFRGCIRALRLTKGTGK
PLEINFAKALELMGVQPVSCPAN
Download sequence
Identical sequences ENSCPOP00000012842 10141.ENSCPOP00000012842 ENSCPOP00000012842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]