SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Cavia porcellus 76_3 > ENSCPOP00000012851

Domain assignment for ENSCPOP00000012851 from Cavia porcellus 76_3

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSCPOP00000012851
Domain Number 1 Region: 711-758
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 1.25e-16
Family Serine proteinase inhibitor lekti 0.0057
Further Details:      
 
Domain Number 2 Region: 571-618
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 1.66e-16
Family Serine proteinase inhibitor lekti 0.01
Further Details:      
 
Domain Number 3 Region: 644-692
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000222
Family Serine proteinase inhibitor lekti 0.01
Further Details:      
 
Domain Number 4 Region: 876-921
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000305
Family Serine proteinase inhibitor lekti 0.02
Further Details:      
 
Domain Number 5 Region: 372-419
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000513
Family Serine proteinase inhibitor lekti 0.0015
Further Details:      
 
Domain Number 6 Region: 504-553
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000929
Family Serine proteinase inhibitor lekti 0.00093
Further Details:      
 
Domain Number 7 Region: 780-828
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000122
Family Serine proteinase inhibitor lekti 0.013
Further Details:      
 
Domain Number 8 Region: 224-267
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000133
Family Serine proteinase inhibitor lekti 0.0069
Further Details:      
 
Domain Number 9 Region: 157-206
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000139
Family Serine proteinase inhibitor lekti 0.0044
Further Details:      
 
Domain Number 10 Region: 953-1008
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000263
Family Ovomucoid domain III-like 0.02
Further Details:      
 
Domain Number 11 Region: 431-474
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000846
Family Serine proteinase inhibitor lekti 0.012
Further Details:      
 
Domain Number 12 Region: 93-151
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000121
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Domain Number 13 Region: 26-74
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000277
Family Serine proteinase inhibitor lekti 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012851   Gene: ENSCPOG00000014264   Transcript: ENSCPOT00000014406
Sequence length 1032
Comment pep:known_by_projection scaffold:cavPor3:scaffold_6:10118287:10172580:1 gene:ENSCPOG00000014264 transcript:ENSCPOT00000014406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
MKTVTVPVLLTLALCLIQDAVSEDANQETCSEFQALMKNGKLFCPQNTKLFQSPDEITFI
NKCASCKKILENAAKSQEGAVHLARATRDTAQAKLNCDDFRRGKKGGEFTCNDGEAAVCG
TDGKTYHNRCELCAENAKTGSQIGIRSEGECESSNSVEDVCRAYRAYVEDGRLGCTREND
PVLGPDGRTHGNKCAMCAELFLKEAEENAKREGKRRIQRNVEKKAFCKEYENQVRNGRLF
CTRESDPIRGPDGKMHGNKCSLCAEMLLIIAQTGTYYLGEKGRSHSIQKNTLKSDTKYSG
DIHKQLKCHSLAVYSTQFHCTNVWKPRCLRGLEREPNGNWGKLWRQFPAQGTQDKARNNS
RHKRQSKNATSFEELCSEYRKSRRNGQLFCTRENDPIQGPDGKVHGNTCSMCEAFFKEED
KARAKAKREAAKENCSEFENLMRSGMFTCTRDNNPVVGPDGKIHANKCVMCASILYILIR
KKRKNKRDKYQKLDVSASSELFDLKELCREYRPYMRNGHLACTRENDPIEGPDGKIHGNT
CSMCEAFFLQEAKEKKDKLRGRVKREAMEYDTCQEYRSLMQNGNLYCTRENDPVRGPDGK
THGNKCAMCKAVLKKERRWQKYLSFRKIHVVSGHGSHGGGGKAEDPCAEYRERMRDGKLS
CTRESDPVRGADGKSYNNKCGMCKELLQREAEEKVKSSSLRSHKTESASGKDVCDEYRSH
MKNGKLSCTRESDPIRGPDGKTHGNKCAMCKTRLEKEAAERKQKEKEGKQNTEDKSNDKK
DQCFEFRSKQKDGRLICTRDNSPFRGLDGKMYVNKCAMCQTLFEREAKERKNDEEKSNSQ
SSKDAKDQCKEVTNEAEDAKFRQPSSSLAYIGISADECSEYRNRARNGELICTRENNPVR
GADGKTYKNKCYRCRAILQKEALERSKLQAEPIYLRASEETPDSSTSSLDSEMCKHYRVL
PRIGFLCPKDLQPVCGDDGKTYSNPCMLCHENLIHQTNTHIRSPGRCEDSKTPETKPGSV
RTGVESSENMLH
Download sequence
Identical sequences ENSCPOP00000012851 10141.ENSCPOP00000012851 ENSCPOP00000012851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.