SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012867 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012867
Domain Number 1 Region: 404-578
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 3.01e-33
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.046
Further Details:      
 
Domain Number 2 Region: 161-230,337-400
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.57e-28
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.081
Further Details:      
 
Domain Number 3 Region: 54-127
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000163
Family Canonical RBD 0.0051
Further Details:      
 
Domain Number 4 Region: 4-46
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000146
Family Classic zinc finger, C2H2 0.063
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000012867
Domain Number - Region: 598-637
Classification Level Classification E-value
Superfamily Cgl1923-like 0.0235
Family Cgl1923-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012867   Gene: ENSCPOG00000014281   Transcript: ENSCPOT00000014423
Sequence length 851
Comment pep:novel scaffold:cavPor3:scaffold_44:15151278:15160727:1 gene:ENSCPOG00000014281 transcript:ENSCPOT00000014423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVDSDVESLPRGGFRCCLCQVTTANRPSLDAHLGGRKHRHLVELRAARKAQGLRSVFV
SGFPRNVDSTELSEYFQAFGPVASVVMDKDKGVFAIVEMGDVASRDAALAQPQHSLRGQR
LRVRPREQKAFQSPVSRGPQGVAPDDSDQLLSTLAEAPDVGGQMLKLVALRELSEAERQL
RRLVVALMQEVFTEFFPGCVVHPFGSSTNSFDVHGCDLDLFLDLGELEEPQPVLKAPESP
SLDSALASPLDPQACTPASSVDLQSPASPHDSEVLDFETLSSSRAPQTPDSALASETLAS
PQSLPPASPLQEDRGEEDLGKGPSLAEAPGHEKPVGAAVLELVGSILRRCVPGVYRVHSV
PSARRPVVKFCHRPSGLHGDISLGNRLALHNSRFLSLCSELDGRVRPLVYTVRCWAQGRG
LTGSGPLLSNYALTLLVIYFLQTRDPPVLPTVAQLTQKAGEEEQVEVDGWDCSFPRDTSN
LESSTNVEPLGSLLAQFFSCVSCWNLRGSLLSLREGQALLVAGGQLADLWEGLRLGPMNL
QDPFDLSHNVAANVTSCVAARLQNCCRAAASYCRSLQYQRRSARGRDWGLLPLLQPCSPA
SLLAATPILLPTVPFPQLAAALVQVLRDALGCQIEQGTKRQRPGAGMEEAAQGGAVKRPK
LDGHREGGKDGAGAEDPWGDTRDLGRGAEEEMVVEAGEAAQDWGMWSPGQSGDLPVVAGQ
CPSPGEGTSHSGPTRPCQGHASWRCALWYRTWQGRRRVRRRLQQQWRQGQGDDTGTEWLA
VEARVTQELARPGSGGEQAARAEPLVTFVASLSEAEGTLTVTPLQDAQGLFPELHHFLQG
FVPQALRQAIK
Download sequence
Identical sequences ENSCPOP00000012867 10141.ENSCPOP00000012867 ENSCPOP00000012867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]