SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012893 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012893
Domain Number 1 Region: 19-103
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.3e-21
Family N-acetyl transferase, NAT 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012893   Gene: ENSCPOG00000014312   Transcript: ENSCPOT00000014454
Sequence length 113
Comment pep:known_by_projection scaffold:cavPor3:scaffold_65:494282:501981:1 gene:ENSCPOG00000014312 transcript:ENSCPOT00000014454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHSAAAVPLGALEQGCPIRVEHDRRRRQFTVRLNGCHDRAVLLYEYVGKRIVDLQHTEV
PDAYRGRGIAKHLAKAALDFVVEEDLKAHLTCWYIQKYVKENPLPQYLERLQP
Download sequence
Identical sequences A0A286XWS8 A0A2I3TN55 A0A2J8R480 A0A2K5DAZ8 A0A2K5PLK1 Q8N6N6
ENSP00000478388 ENSCPOP00000012893 ENSCPOP00000012893 NP_690878.2.87134 NP_690878.2.92137 XP_002827185.1.23681 XP_003465932.1.53824 XP_004640373.1.9945 XP_016786290.1.37143 XP_017366057.1.71028 XP_021522957.1.9421 gi|116325985|ref|NP_690878.2| 10141.ENSCPOP00000012893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]