SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013061 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013061
Domain Number 1 Region: 192-304
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-17
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 2 Region: 140-178
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000209
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 3 Region: 399-436
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000288
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 4 Region: 34-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000458
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000013061
Domain Number - Region: 329-354
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00034
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number - Region: 357-398
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000838
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013061   Gene: ENSCPOG00000014495   Transcript: ENSCPOT00000014640
Sequence length 714
Comment pep:known_by_projection scaffold:cavPor3:scaffold_13:17893770:17898535:-1 gene:ENSCPOG00000014495 transcript:ENSCPOT00000014640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALTLLPFLALPLGGALAHPDRTISSNRACTNSPALLLEVQGTLQRPLGRDSRSFPANCTW
IILGSKEQTVTVRFQKLHLACGSERLLLRSPLQPLISLCEAPASPLQLPGGNVTITYSYA
GARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCIPAAQRCDGVDACGDGSDEAGCSSDLF
PSLTPDASPILSCNLTLEDFYGVFSSPGFAHFSSVSHPQSCLWLLDPHDGRRLAVRFTTL
DLGPGDAVHVYDGPGPPETPRLLRSLTHFSNGKAVTVETLSGQAVVTYYTPAKNSGRGFN
ATYHVRGYCLPWDRPCGLRSGLGAGESLGERCYSDAQRCDGSWDCADGTDEEGCPGCPPG
HFPCGVAGTPGATACYLLADRCNYQTFCADGADERRCRHCQPGNFRCQDEKCVYETWVCD
GQPDCADGSDEWECSYALPRKVITAAVIGSLVCGLLLVIALGCTCKLYAIRTQEYSIFAP
LSRMEAEIVQQQAPPSYGQLIAQGAIPPVEDFPTENPNDNSVLGNLRSLLQILRQDMTPG
GASGGRRRQRGRSMRRLVRRLRRWGLLPRINSSARTPETRSQVTPSSAPPEGLDGSTGSA
CEGGAVGGQEGEQAPALPIKTPLPCASTTPALPTVPEAPGPLPSVPLEPSLLSGVVQALR
GRLLPSLWPPGPTWTPPGPHTAVLAPEDEDDVLLMPLAEPGVWVVEAEDEPLLS
Download sequence
Identical sequences ENSCPOP00000013061 10141.ENSCPOP00000013061 ENSCPOP00000013061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]