SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013083 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013083
Domain Number 1 Region: 297-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000921
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 2 Region: 364-422
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000188
Family Laminin-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000013083
Domain Number - Region: 420-467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000193
Family Laminin-type module 0.018
Further Details:      
 
Domain Number - Region: 472-500
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000484
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 121-177
Classification Level Classification E-value
Superfamily Sialidases 0.0373
Family Sialidases (neuraminidases) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013083   Gene: ENSCPOG00000014518   Transcript: ENSCPOT00000014663
Sequence length 539
Comment pep:known_by_projection scaffold:cavPor3:scaffold_2:31640864:31946983:1 gene:ENSCPOG00000014518 transcript:ENSCPOT00000014663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLSRFLSIHALWVTVSSVMQPYPLVWGHYDVCKTQIYTEEGKVWDYMACQPESTDMTKY
LKVKLDPPDITCGDPPESFCAMGNPYMCNNECDASTPELAHPPELMFDFEGRHPSTFWQS
ATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYAT
DCLDAFHMDPKSVKDLSQHTVLEIICTEEYSTGYTTNSKIIHFEIKDRFAFFAGPRLRNM
ASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHLARYFYAISDIKVRGRCKCN
LHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGTANTCIPSISS
IGNCECFGHSNRCSYIDLLNTVICVSCKHNTRGQHCELCRLGYFRNASAQLDDENVCIEC
YCNPLGSIHDRCNGSGFCECKTGTTGPKCDECLPGNSWHYGCQPNVCDNELLHCQNGGTC
HNNLRCLCPAAYTGIFCEKLRCEEAGSCGSDSGQAAPPQCSPALLLLTALLGTASPLAF
Download sequence
Identical sequences H0VR84
ENSCPOP00000013083 10141.ENSCPOP00000013083 ENSCPOP00000013083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]