SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013200 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013200
Domain Number 1 Region: 1-398
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.83e-75
Family Integrin alpha N-terminal domain 0.00000368
Further Details:      
 
Domain Number 2 Region: 399-558
Classification Level Classification E-value
Superfamily Integrin domains 9.42e-30
Family Integrin domains 0.0016
Further Details:      
 
Domain Number 3 Region: 562-699
Classification Level Classification E-value
Superfamily Integrin domains 3.3e-28
Family Integrin domains 0.0036
Further Details:      
 
Domain Number 4 Region: 706-884
Classification Level Classification E-value
Superfamily Integrin domains 4.19e-16
Family Integrin domains 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013200   Gene: ENSCPOG00000014650   Transcript: ENSCPOT00000014795
Sequence length 973
Comment pep:known_by_projection scaffold:cavPor3:scaffold_16:36653712:37044038:-1 gene:ENSCPOG00000014650 transcript:ENSCPOT00000014795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLVGAPKADSKYSTSVKSPGAVFKCRVHTNPDRRCTELDMARGKNRGAACGKTCREDRDD
EWMGVSLARQPGADGRVLACAHRWKNIYYETDHILPHGFCYIIPSNLQAKGRTLIPCYEE
YKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFYWAGTVKVLNLTDNTYFKLNDETIMNR
RYTYLGYAVTAGHFSHPSSTDVVGGAPQDEGIGKVYIFRADRRSGTLIKIFQASGKKMGS
YFGSSLCAVDLNRDGLSDLLVGAPMFSEVRDEGQVTVYINRGNGVLEEQLALTGDRAYNA
HFGESIAGLGDLDDDGFADVAIGAPKEDDFAGAVYIYHGDAGGIVPQYSMKLSAQKINPV
LRMFGQSISGGIDMDGNGYPDVTIGAFVSDSVVLLRARPVITVDVSIFLPSSINITAPQC
HDGQQPINCLNVTVCFRFHGRHVPGEIGLNYILTADVAKKEMGQLPRVYFVLLGETAGQV
LEKLQLAHTEELCHHYVAHVKRRVQDVISPIVFEAAYNLGTHVTGEEERELPALTPVLRW
KKGQKIAQKNQTIFERNCRSEDCAADLQLQGKLLLSSIDEKTPYLALGAVKNISLNISIS
NRGDDAYDANVSFNVSRELFFINMWQKEEMGISCELLESDFLKCSVGFPFMRSKSKYDFS
VIFDTSHLSGEEDVLSFIITAQSGNVERSEALLDNTLILTVPLVHEVDTSITGIVSPTSF
VYGESVDTSNFIQLDDLECHFQPLNITIQVYNTGPSALPGSSVSISFPNRLTPGGAEMFQ
VQEMVVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGRKVLDCENPGMPCLTIH
CNLSALNKEESRTIDVYMLLNTEILKKDSSSVIQFMARAKVKVESALQVVEVPNGNPEEM
MVVFEALHNLEPRGYVVGWIIAISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEKNRK
ENEDSWDWVQKNQ
Download sequence
Identical sequences ENSCPOP00000013200 ENSCPOP00000013200 10141.ENSCPOP00000013200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]