SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013317 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013317
Domain Number 1 Region: 956-1170
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.09e-104
Family Thrombospondin C-terminal domain 0.00000000127
Further Details:      
 
Domain Number 2 Region: 29-233
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.49e-39
Family Laminin G-like module 0.00000000902
Further Details:      
 
Domain Number 3 Region: 833-954
Classification Level Classification E-value
Superfamily TSP type-3 repeat 5.36e-37
Family TSP type-3 repeat 0.000000134
Further Details:      
 
Domain Number 4 Region: 490-547
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 3.4e-17
Family TSP-1 type 1 repeat 0.0000227
Further Details:      
 
Domain Number 5 Region: 436-485
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 3.92e-16
Family TSP-1 type 1 repeat 0.0000373
Further Details:      
 
Domain Number 6 Region: 752-835
Classification Level Classification E-value
Superfamily TSP type-3 repeat 6.41e-16
Family TSP type-3 repeat 0.0000771
Further Details:      
 
Domain Number 7 Region: 317-375
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000324
Family VWC domain 0.0077
Further Details:      
 
Domain Number 8 Region: 380-429
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000249
Family TSP-1 type 1 repeat 0.00065
Further Details:      
 
Domain Number 9 Region: 548-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000262
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013317   Gene: ENSCPOG00000014779   Transcript: ENSCPOT00000014924
Sequence length 1172
Comment pep:known_by_projection scaffold:cavPor3:scaffold_10:25214492:25226756:1 gene:ENSCPOG00000014779 transcript:ENSCPOT00000014924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLAWGLSVLFLVHVCGTNRIPESGGDNSVFDIFELTGATRKGSGRRLVKGPDPSSPAFR
IENANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQLKKTRGTLLAVERKDQSGQIFSVV
SNGKAGTLDLSLSAQGKQQVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELD
VPIQNIFTRDLANIARLRIAKGDVNGNFQGVLQNVRFVFGTTPEDILRNKGCSSSATNVL
LTLNNNVVNGSSPAIRTNYIGHKTKDLQAICGISCEELSSMFLELRGLRTIVTTLQDSIR
KVTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCS
NATVPDGECCPRCWPSDSADDGWSPWSEWTACSVTCGNGIQQRGRSCDSLNNRCEGSSVQ
TRTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEAR
ETKPCKRDACPINGGWGPWSLWDICSVTCGGGVQKRSRLCNNPMPQFGGKDCIGDVTETQ
VCNTQECPIDGCLSNPCFAGTKCTSYPDGSWKCGACPAGYSGNGIQCKDVDECREVPDAC
FNHNGEHRCKNTDPGYNCLPCPPRFTGTQPFGRGVEHATANKQVCKPRNPCTDGTHNCNK
NAKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNEDLLCVANATYHCKKDNCP
NLPNSGQEDYDKFNEGLKHLRIQENYKIITDDDNCPFHYNPAQYDYDRDDVGDRCDNCPY
NHNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLE
HNPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDD
NDGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDNVPDIDDICPENVDISETDFRR
FQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAIGFDEFNAVDFSGTFFINTERD
DDYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNA
LWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFISRVVMYEGKKIMADSGPI
YDKTYAGGRLGLFVFSQEMVFFSDLKYECRGR
Download sequence
Identical sequences ENSCPOP00000013317 ENSCPOP00000013317 10141.ENSCPOP00000013317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]