SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013368 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013368
Domain Number 1 Region: 59-124
Classification Level Classification E-value
Superfamily Leucine zipper domain 2.18e-19
Family Leucine zipper domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013368   Gene: ENSCPOG00000014835   Transcript: ENSCPOT00000014980
Sequence length 150
Comment pep:known_by_projection scaffold:cavPor3:scaffold_201:933949:934398:1 gene:ENSCPOG00000014835 transcript:ENSCPOT00000014980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKIVQHSGAPGVNGVSVIHTQAQASGLQQVPQLVPAGPGGGGKAAAPSKQSKQSSPTDG
NSDEDRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKD
LFLEHAHNLADNVQPISTENTTTNSDAAGQ
Download sequence
Identical sequences A0A286Y331
10141.ENSCPOP00000013368 ENSCPOP00000013368 ENSCPOP00000013368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]